KEGG   Glycine soja (wild soybean): 114367038Help
Entry
114367038         CDS       T06057                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53-like isoform X1
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
gsj  Glycine soja (wild soybean)
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gsj03009]
    114367038
Enzymes [BR:gsj01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     114367038
Ribosome biogenesis [BR:gsj03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    114367038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL
Motif
Other DBs
NCBI-GeneID: 114367038
NCBI-ProteinID: XP_028179926
LinkDB All DBs
Position
1
AA seq 503 aa AA seqDB search
MGFWGIEVKPGKPCPYHADNVRGKLHVTQATLGIGSSSEKSILQCSSGHKSPVFLCSLLP
DKVESCPLNLEFDADDLVAFSVVGSRSIHLSGYFADDDGDDLRDDYEYDSWGEDIEGTES
EESSEYDSEDGYADDFIVDSDTDMYPSSPIPNSGVVIEEIMDDDKPKNGDDPTKKLKKKK
HVAQLKEKDNKSSELPIVAKGDTDLVVESEDEDGFPISIAEKGVSVSKTEAEMKGEQARK
KTEKANKKEKDVGHSASVKRKVDSADEDEPQDGKKKKKRNKLKDHIKGGSDHASDNSNEK
KVTEPDEKHAEDVKTSTKLSDVSHAKDEDGGKLSNNEVLVEKKIKKKNKKKTKESEGEAA
TNQITTTAEKQNLSTEKKGKKQTETKPSQVRTFPNGLIIEEVFMGKPDGKKAAPGKKVSV
KYIGKMQKDGKIFDSNVGRAPFKFRLGVGQVIKGWEVGINGMRIGDKRRITIPPSMGYAD
KRVGSIPPSSWLVFDVELVDVGR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctgggggattgaagtgaaacctggcaaaccgtgtccttatcacgctgacaat
gtgcgagggaagcttcatgttactcaggctactctaggcattggctcatcatcggagaaa
agcattcttcagtgctcttctggacacaaaagtccagttttcttgtgttcattgctacca
gataaggttgagtcatgccctttgaatcttgagtttgacgcagatgacttagtggcattc
tcggttgttggctcacgaagcatccacctttcaggttattttgcggatgacgatggggat
gatcttagggatgactatgaatatgattcatggggagaggatattgaaggaactgagtca
gaggagtcgtctgaatatgatagtgaagatggatatgctgatgactttattgttgatagt
gatacagacatgtacccgtcttcaccaatcccaaatagtggagttgtaattgaggaaata
atggatgatgataaacccaaaaatggagatgatccaactaagaaattaaagaaaaagaag
catgtagctcagttgaaagagaaagacaacaaaagttctgagcttccaattgttgctaag
ggtgatactgaccttgttgtggaaagtgaagatgaagatggctttccaatttccattgca
gagaaaggtgtgtctgtctctaagacagaagcagaaatgaaaggagaacaagcacgtaag
aaaactgagaaagccaacaagaaggaaaaagatgttggtcattctgctagtgtaaaacga
aaagttgatagtgctgatgaagatgagcctcaggatgggaaaaagaagaagaaaagaaac
aagttgaaagatcatattaaagggggaagtgatcatgcatctgacaatagcaatgagaaa
aaggttactgaaccagatgaaaaacatgccgaggatgttaaaacttcaaccaaactgagt
gatgtttctcatgcaaaggatgaagatggtggaaagctatccaataacgaggtccttgtt
gagaagaaaatcaagaagaaaaacaagaaaaagaccaaagagtctgaaggggaagctgcc
acaaatcaaattactacaactgctgaaaaacagaatttgtccacagagaaaaaggggaag
aaacaaactgaaaccaagccatcacaagtgagaacttttccaaatggattgattatagag
gaggtgtttatgggtaaacctgatggcaaaaaagctgctcctggaaagaaggttagtgtt
aaatatattggcaaaatgcaaaaagatgggaaaatatttgactcaaatgtgggaagagca
ccctttaaatttcgcctgggtgtaggacaagtcatcaaagggtgggaggttgggatcaat
gggatgagaattggggacaaacgaaggatcacaattccaccgtctatgggatacgcggac
aaacgcgttggcagtataccaccaagttcgtggcttgtatttgatgtggagttggttgat
gttggtcgctga

DBGET integrated database retrieval system