KEGG   Glycine soja (wild soybean): 114372510Help
Entry
114372510         CDS       T06057                                 

Definition
(RefSeq) probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC
  KO
K09667  protein O-GlcNAc transferase [EC:2.4.1.255]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    114372510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gsj01003]
    114372510
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gsj03036]
    114372510
Enzymes [BR:gsj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     114372510
Glycosyltransferases [BR:gsj01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   114372510
Chromosome and associated proteins [BR:gsj03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     114372510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_41 TPR_1 TPR_11 TPR_2 TPR_8 TPR_7 TPR_17 TPR_16 TPR_12 TPR_14 TPR_19 TPR_10 TPR_9 TPR_6 NARP1 TPR_MalT EST1_DNA_bind BTAD ANAPC3 TPR_15 TOM20_plant TPR_21 SNAP Coatomer_E
Motif
Other DBs
NCBI-GeneID: 114372510
NCBI-ProteinID: XP_028185900
LinkDB All DBs
Position
10
AA seq 988 aa AA seqDB search
MISAQGDHHRHHHHYHHQPQLPGSADTSRQQFTADRVEPFSVKQEPASLTLLPLRGHDSS
EVDEDVYLSLAHQMYKTGNYKQALEHSNTVYERNPLRTDNLLLLGAVYYQLHDFDMCVAK
NEEALRIEPHFAECYGNMANAWKEKGNIDLAIRYYLIAIELRPNFADAWSNLASAYMRKG
RLTEAAQCCRQALAINPLMVDAHSNLGNLMKAQGLVQEAYSCYLEALRIQPTFAIAWSNL
AGLFMESGDFNRALQYYKEAVKLKPSFPDAYLNLGNVYKALGMPQEAIACYQHALQTRPN
YGMAYGNLASIYYEQGQLDMAILHYKQAVACDPRFLEAYNNLGNALKDVGRVEEAIQCYN
QCLTLQPNHPQALTNLGNIYMEWNMVAAAAQYYKATLNVTTGLSAPYNNLAIIYKQQGNY
VDAISCYNEVLRIDPLAADGLVNRGNTYKEIGRVSDAIQDYIRAIVVRPTMAEAHANLAS
AYKDSGHVEAAVKSYKQALILRPDFPEATCNLLHTLQCVCCWEDRDKMFKEVESIIRRQI
NMSVLPSVQPFHAIAYPLDPMLALEISRKYAAHCSVIASRFALPPFNHPSPIPIKREGGY
ERLRIGYVSSDFGNHPLSHLMGSVFGMHNRKNVEVFCYALSANDGTEWRQRIQSEAEHFV
DVSAMSSDAIAKMINEDKIHILVNLNGYTKGARNEIFAMQPAPIQVSYMGFPGTTGATYI
DYLVTDEFVSPLGYANIYSEKIVHLPHCYFVNDYKQKNQDVLDPNCPHKRSDYGLPEDKF
IFACFNQLYKMDPEIFNTWCNILKRVPNSALWLLRFPAAGEMRLRAYAAAQGVQPDQIIF
TDVATKNEHIRRSSLADLFLDSPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLA
TGLGDEMIVSSMKEYEDRAVSLALNRPKLKALTNKLKAVRLTCPLFDTARWVRNLERSYF
KMWNLHCSGQRPQHFKVTENDLECPYDR
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgatctccgcgcagggcgaccaccaccgccaccaccaccactaccaccaccagccgcag
cttcccggctccgccgacacctctcggcagcagttcaccgcggatcgcgtcgagcccttc
tccgtcaagcaggaacccgcgtcgctcactcttctgccgttacgcggtcatgattctagt
gaagttgatgaagatgtgtacttgtctcttgcacatcaaatgtacaagactggcaattat
aagcaagccctagaacacagcaacactgtctatgagagaaatccgctccgtactgacaac
ttactactcctgggtgcagtttattatcagttgcatgattttgatatgtgtgttgcaaaa
aatgaagaagcactgaggattgagccacactttgctgagtgttacgggaatatggcaaat
gcatggaaggagaaaggaaacattgaccttgcaattcgctactacttgattgccatagag
ctccgtcccaattttgctgatgcatggtcaaatctagctagtgcatacatgcgtaaagga
agactcactgaagcagcccagtgttgtcgtcaagcacttgctataaatcctctaatggtt
gatgcccatagcaacttgggtaatcttatgaaagctcaaggcttggtgcaagaagcatac
agttgttaccttgaggcattgcgcattcaacctaccttcgctattgcatggtcaaatctt
gctggcctgttcatggagtctggtgatttcaacagagcccttcagtattacaaggaagca
gtgaaactaaaaccttccttccctgatgcatatctgaaccttgggaatgtatacaaggct
ttagggatgcctcaagaagctattgcatgttatcaacatgctcttcagacacgaccaaac
tatggcatggcttatggtaatttggccagtatatattatgagcaaggtcaactggatatg
gcaattctacactataaacaagctgttgcatgtgaccccagatttttggaagcttacaat
aacttgggtaatgctctaaaagatgttggcagagtggaggaagcaatccagtgctataat
caatgccttacattacagcccaaccatccacaagcattgaccaatcttggaaatatatac
atggaatggaacatggtagctgctgctgctcaatattataaagctacactgaatgtaaca
actgggttgtctgctccttataacaaccttgccataatctataagcagcaggggaattat
gtagatgccatatcgtgctacaatgaggtcctccgcattgaccccttggcagctgatgga
ctagtaaatagaggcaatacatataaggagattggtagagttagtgatgctatccaggat
tacatacgggcaattgttgtcaggcccaccatggcagaagcccatgctaatttggcttct
gcttataaagatagtggacatgtagaggctgctgtgaagagctataaacaagcattgatt
cttcgtccagacttccctgaagcaacttgcaatctccttcatacacttcagtgtgtctgc
tgttgggaggatcgcgataaaatgttcaaggaagttgaatcaataatcaggaggcagatt
aatatgtctgttcttcctagtgtccagccattccatgccatagcatatcctcttgatcca
atgcttgctctggaaattagccgtaaatatgctgcacactgctcggtaattgcatctcgt
tttgctcttcctccattcaaccatccttctcctattccaatcaagcgcgagggaggatat
gaaagactaaggattggttatgtgagtagtgactttggtaatcatcccttgtctcatctc
atgggatctgtttttggtatgcacaacaggaagaatgtggaggtgttctgctatgccttg
agtgctaatgatggtactgaatggaggcaacgtattcagtctgaagcagagcactttgtg
gatgtatctgccatgtcatcagatgcaatagcaaaaatgattaatgaggataagatacat
atccttgtcaacctaaatggttatactaagggtgccagaaatgagatatttgctatgcaa
cctgcaccaattcaagtttcatatatgggattccctggaacaactggggctacttacata
gactacttagtcactgatgagtttgtttcaccactagggtatgcaaatatatattcagag
aagattgtacatctcccccattgctactttgtaaatgattataaacagaaaaatcaagat
gtgttagatcccaactgcccacacaaacgatcagattatggtctacctgaggataaattt
atatttgcatgcttcaatcaactgtacaagatggatcctgaaatatttaatacatggtgt
aatattcttaaacgtgtacccaacagtgcactctggctcctcagatttcctgcagctggg
gaaatgagactgagagcatatgctgctgcacaaggggtacaaccggatcaaattattttc
acagatgttgccacgaagaatgaacacatcagaagaagttctttagcagacttattcctt
gactcgcctttatgcaatgcacatacaacaggaacagatatactttgggcaggtttgcca
atggttactctgcctcttgaaaaaatggctactagggttgcgggctcactctgtcttgcc
actggactaggggacgagatgattgttagcagcatgaaagagtatgaagatagagcagtc
tcattggctctgaatcggccgaagcttaaagctcttactaataagcttaaagctgtacgc
ttgacttgccctctatttgacactgcccgctgggtgaggaatcttgagagatcatatttt
aaaatgtggaatctgcattgctctggtcaacgtcctcagcattttaaggtcactgaaaat
gatctcgaatgcccttacgacaggtag

DBGET integrated database retrieval system