KEGG   Glycine soja (wild soybean): 114388284Help
Entry
114388284         CDS       T06057                                 

Definition
(RefSeq) ent-kaurene oxidase, chloroplastic-like
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00904  Diterpenoid biosynthesis
gsj01100  Metabolic pathways
gsj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    114388284
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:gsj00199]
    114388284
Enzymes [BR:gsj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     114388284
Cytochrome P450 [BR:gsj00199]
 Cytochrome P450, plant type
  CYP701 family
   114388284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 DUF3890
Motif
Other DBs
NCBI-GeneID: 114388284
NCBI-ProteinID: XP_028204497
LinkDB All DBs
Position
15
AA seq 507 aa AA seqDB search
MESLTLSVTVAVVAFSTLLFLLLLTRRHAGVGAGAGAGSLPPVPAVPGLPVIGNLLQLKE
KKPYKTFTHMTHKHGPIYSIRTGASTLIVLNSPHLAKEAMVTRFSSISTRKLSNALKILS
SDKCMVATSDYNEFHKTVKRHILTNLSGANAQKRHRIRREAMMENILSQFSEHIKTFSDL
AANFRKIFATQLFGLALKQALGSNVETIYVEELGSTLSKEDIYKILVVDISEGAIEVDWR
DFFPYLKWIPNRRMEMKIQNLHVRRKAVMKALMNEQKNRMASGKKVHCYFDYLVSEAKEL
TEDQISMLIWETIIGTSDTTLVTTEWAMYELAKDKTRQDRLYEELQYVCGHENVIEDQLS
KLPYLGAVFHETLRKHSPAPMVPPRYVHEDTQLGGYHIPAGSEIAINIYGCNMDSNRWEN
PYEWMPERFLDEKYDPVDLYKTMAFGAGKRVCAGSLQAMLIACTAIGRLVQEFEWELGQG
EEENVNTQCFTTRKLHPLLVKLKPRIK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggagtccctcaccctttcagttactgtagccgtagttgctttttctaccctcttgttc
ctcctgctactcactagaagacatgcgggagtcggagccggagccggagccggatcactt
cccccagtaccagcggttccaggattaccagtgatagggaatcttctgcaattgaaggag
aagaaaccttacaagaccttcacacatatgactcacaaacatgggcccatctattccatc
cgaaccggtgcttccactctcattgttctcaactctccccaccttgctaaggaggcaatg
gtcaccagattttcatcaatttcaacaaggaagctatccaatgcactcaagattctctct
tctgataaatgtatggttgccactagtgactacaatgaatttcacaaaacggtcaaaaga
catattcttactaacctctcaggagccaatgcacagaagcgacaccgtatccgcagagaa
gccatgatggaaaatattttgagccagtttagtgaacatatcaagaccttctctgatttg
gcagctaattttaggaaaatattcgctactcaactatttggattagcactgaagcaagct
ctgggaagtaatgtagagaccatttatgtggaggaacttgggagtacattatcaaaagag
gacatatataagattctagtggtcgatatatcggagggtgcaattgaggtggattggcga
gatttctttccatacctgaagtggattccaaataggaggatggagatgaaaattcagaat
ctgcatgtgcgcagaaaagctgtcatgaaggccttgatgaatgagcaaaagaacagaatg
gcttcaggaaagaaagtacattgctattttgactacctggtgtcggaagctaaagaactg
actgaagatcaaatttccatgctaatctgggaaaccattattgggacatctgatactaca
ttagttacaactgaatgggctatgtatgaacttgccaaagacaaaacacgtcaggaccgt
ctttatgaggagctccaatatgtatgtggacatgaaaatgttatagaagaccaattatct
aagctaccttacttgggggcagtattccatgaaactttaaggaagcatagtccagctccc
atggttccaccaagatatgttcatgaagacacacaattgggaggatatcatattcctgca
ggaagcgagatcgcaataaatatatacggatgcaacatggacagcaatcggtgggaaaat
ccttatgagtggatgcctgagaggtttcttgatgagaaatatgaccccgtggatttatac
aagacgatggcctttggagcagggaagagggtgtgtgcaggctctcttcaggccatgttg
atagcttgcactgcaattggaagattggttcaggaatttgagtgggaactcggacaaggg
gaggaagagaatgtcaatacacagtgctttaccacccgcaagctccatccactgctagta
aaactcaagccaagaatcaagtaa

DBGET integrated database retrieval system