KEGG   Glycine soja (wild soybean): 114396090Help
Entry
114396090         CDS       T06057                                 

Definition
(RefSeq) ribonuclease II, chloroplastic/mitochondrial isoform X1
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
gsj  Glycine soja (wild soybean)
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gsj03016]
    114396090
Enzymes [BR:gsj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     114396090
Transfer RNA biogenesis [BR:gsj03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    114396090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-GeneID: 114396090
NCBI-ProteinID: XP_028213779
LinkDB All DBs
Position
18
AA seq 784 aa AA seqDB search
MMAVRAVTSCSLFRPSSPPLFSSALRFFPYRSRGPPSLSLRYGAHTQTRSVQSLFNSLME
ELRAARKRRQKRVSAAASNRMGLLNEELAEDRLVNHSLQKGLLLEFKKDSDRVLLAVAQR
PDGKKNWMVSDQNGFTSSIKPQQVTYIVPGIDNFDQADIADFAQKAQDNMDPSLLEFAWV
ELLEKNKSVTVEELAEIIFGSTEALESYSAHLLLSKDEVYFTVLETKGFRSVYGPRPSGQ
VEELIHQKLAKEAVEKEFQEFIELLASVKSMSSQDKPPKHSWTKDERIWSRIESLEAYAI
DACKNDEQRKTAGMQVLKEMGLAKTASSAVKLLIDIGYFPVHINLDLLKLGIPTDHSDEI
ISAAQSLLLDSSDPDEIDRKNLTDLKVYAIDVDEADELDDALSATKLQDGRIKVWIHVAD
PTRYVQPGSIVDREAMRRGTSVFLPTATYSMFPENLAMGGMSLRQGELCNAVTVSVVLHN
DGSIAEYSVFNSVIKPTYMLTYESASELLHLNLQEEGELRILSEAANLRSNWRRQQGAIE
TATLDTRIKVSNPEDPEPSMKLYVENQADPAMRLVSEMMILCGEAVATFGSRNDIPLPYR
GQPQSDMNVSEFSHLPEGPVRSFALVRVMRAAEIDFRKPARHGVLGIPGYVQFTSPIRRY
LDLLAHYQVKAFLRGKPPPFTAGKLEGIAAVVNENVRTVRKLCSSSLRYWILEYLRRQPK
ERTYRALVLRFLKDRIAALLLLEVGFQASAWIPVGMQIGDEVEVKVEEAHPRDDILFLKE
VVKE
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgttcgagcagtgacctcctgctccctcttccgcccttcctctccgcccctc
ttttcctccgccctccgtttcttcccctatcgctcccgcggccccccttccctctctctc
cgctatggggcccacacccagacgcgctccgtccaaagcctcttcaacagcctcatggag
gagcttcgagccgcgcgcaaacgccgccagaagcgcgtctccgccgccgcttccaaccgc
atgggattgttgaatgaagagcttgctgaagatagacttgtgaaccattcattgcaaaaa
gggttgcttttggaattcaagaaggattctgatagagtattgctagcagttgctcagaga
cctgatggcaagaagaactggatggtttctgatcagaatggtttcacttcttccatcaaa
ccgcagcaagtgacatatattgttcctggtattgacaattttgaccaagcagatattgca
gattttgctcagaaggctcaggataatatggacccatcactacttgaatttgcttgggta
gagctccttgaaaagaataagtctgttacagttgaagagttggctgagataatttttggc
agtactgaggcccttgagagctattctgcgcatctcttgctatcaaaagacgaagtatac
tttactgtactggagactaaaggatttcgttccgtttatggccctcgaccaagtgggcag
gttgaggagcttattcatcagaagcttgcaaaggaggctgttgagaaagaatttcaggag
tttattgaattactggcctctgtgaagtcaatgtcttcacaagacaaacctccaaaacat
tcatggacgaaggatgagagaatttggagcagaattgagtcacttgaagcatatgctatt
gatgcatgtaaaaatgacgaacaaaggaaaacggctgggatgcaggtacttaaagaaatg
ggtttggcaaaaacagcatcttcagctgtaaaacttctgatagatattggatattttcct
gtacatatcaatcttgatctgttgaagttgggaattcccactgatcattcagatgaaatc
atatcggctgctcaaagtcttttattggactcatctgatccagacgagattgataggaag
aatcttaccgatttaaaggtctatgccattgatgttgatgaggctgatgagcttgatgat
gctttgagtgcaacaaagttgcaagatggtcggattaaagtgtggatacatgttgcagat
ccaactagatatgttcaacctggaagtattgtggacagggaggctatgagaagaggaact
tctgttttcttgcccactgctacatattctatgtttccagaaaatcttgccatggggggc
atgagtttgagacaaggagagctttgtaatgcagttactgtatcagttgtgctgcataat
gatggcagcattgcagaatattcagtgtttaactcagtgattaaaccaacatacatgctt
acatatgagagtgcatctgagctactccatttgaaccttcaggaggagggtgaactcaga
attttgtctgaggctgcaaaccttcgttcaaattggcgccgtcagcagggcgcgattgag
acagcaacattagatactcgcattaaagtgtctaatccagaggatccagagccatcaatg
aaactttatgtggaaaaccaggcagaccctgcaatgcgattagtctctgagatgatgata
ctttgcggtgaagctgttgccacatttggatctcggaatgacattcctttaccatacagg
ggacagccccaatcagatatgaatgtttctgaattttcccatctcccagaaggacctgtt
aggagctttgcactggtcagagtaatgcgtgctgctgaaatcgatttcaggaagccagca
cgccatggtgttttggggattcctggttacgttcagtttacatcccccatccgtagatat
ttggatcttcttgctcattatcaggtaaaggcattccttagaggcaagcctccacccttt
acagctggtaagcttgaagggatagcagctgttgtaaatgagaatgttagaacagtgagg
aaactctgcagcagcagtcttcggtactggatattagaatatttacgaagacaaccaaaa
gagagaacatatcgtgcattggtccttagatttttgaaagatcgaattgcagctctattg
ttgcttgaggttggatttcaagcttctgcctggatccctgtaggaatgcagataggggat
gaagtagaagttaaggtggaagaagcacatccacgtgatgatattctatttctgaaggag
gttgtaaaagagtga

DBGET integrated database retrieval system