KEGG   Glycine soja (wild soybean): 114409139Help
Entry
114409139         CDS       T06057                                 

Definition
(RefSeq) NADP-dependent malic enzyme isoform X1
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00620  Pyruvate metabolism
gsj00710  Carbon fixation in photosynthetic organisms
gsj01100  Metabolic pathways
gsj01200  Carbon metabolism
Module
gsj_M00169  CAM (Crassulacean acid metabolism), light
gsj_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    114409139
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    114409139
Enzymes [BR:gsj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     114409139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic DUF4895
Motif
Other DBs
NCBI-GeneID: 114409139
NCBI-ProteinID: XP_028228270
LinkDB All DBs
Position
4
AA seq 618 aa AA seqDB search
MMWLNRHRHNINILLPPTKQGLVQKLLAVTMSSTSLKEMRNGGEDYSNGHGGGVRDLYGE
DCATEDQLITPWTFSVASGCSLLRDPRYNKGLAFTEGERDAHYLRGLLPPAVFNQELQEK
RLMHNLRQYEVPLHRYMAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSI
FRRPQGLYISLKEKGKILEVLKNWPEKSIQVIVVTDGERILGLGDLGCQGMGIPVGKLSL
YTALGGVRPSSCLPITIDVGTNNEKLLNDEFYIGLKQKRAAGQEYAELLEEFMRAVKQNY
GEKVLVQFEDFANHNAFDLLEKYSSSHLVFNDDIQGTASVVLAGLLASLKLVGGTLADHT
FLFLGAGEAGTGIAELIALEISKQTKAPVEKTRKKIWLVDSKGLIVSSRLESLQHFKKPW
AHEHEPVKTLLDAVKAIKPTVLIGSSGAGKTFTKEVVETMASLNEKPLILALSNPTSQSE
CTAEEAYTWSKGKAIFASGSPFDPVEYEGKVFVPGQANNAYIFPGFGLGLIISGAIRVRD
EMLLAASEALAAQVSQENYDKGLIYPPFSNIRKISAHIAAKVATKAYDLGLASHLPRPKD
LVKYAESCMYSPGYRSYR
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggctcaataggcacaggcacaacattaatattctgctaccacctacaaaacag
ggactagtacaaaagttgttggcagtgaccatgtcgagcacttcgttgaaggagatgagg
aacggtggtgaggattatagcaatggtcatggtggtggtgtaagggacttgtatggagag
gattgtgccacagaggaccagcttatcaccccatggactttctctgtggccagtggatgc
agtttgctgagagatccacgctacaacaaaggactggcctttactgagggagagagagat
gcccattacttgcgtggccttttgcctccagctgtcttcaatcaagaacttcaggaaaag
aggttgatgcacaatcttcgccagtatgaggttcctctacataggtacatggccatgatg
gatcttcaggagaggaatgaaaggctgttttacaagcttctgatcgataatgttgaggaa
ctgcttcctgttgtttacactccaactgttggagaagcatgccagaaatacggaagtatt
tttaggcgtcctcagggtctatatatcagtttgaaggagaaaggcaagatccttgaagta
ctgaaaaactggccagaaaagagtattcaagttattgttgtgactgatggtgagcgtata
ttaggacttggagatcttggttgccagggtatgggaattcctgttgggaaactttctctc
tatacggctttaggaggtgtccgcccttcatcttgcttgccaataaccattgatgttggc
acaaacaatgagaagttgctgaatgatgagttttacattggacttaaacaaaagcgggca
gctgggcaggaatatgcggagcttctagaggagttcatgcgcgcagttaagcagaattat
ggggagaaagttctcgtacagtttgaggattttgccaatcataatgcatttgatctgctg
gaaaaatacagctcatctcatcttgttttcaacgatgatatacagggtacagcatctgtg
gtattagcaggattgcttgcatccctgaaattagttggggggaccttagctgaccatacc
ttcttattcctgggtgctggagaggctggaactggtatagctgagctgatagctcttgag
atttcaaagcagactaaagctccagtggaaaagacccgcaagaagatatggctcgtggac
tcaaagggacttattgttagctctcgattggaatcacttcagcacttcaaaaagccttgg
gcccatgagcatgaacctgttaagactcttctagatgccgtcaaggcaatcaagccaacc
gttttgattggatcatctggagcagggaagacatttaccaaggaggtggttgaaaccatg
gcatccctgaatgagaaaccactcattcttgctctctccaacccaacttcacaatctgag
tgcacggctgaagaagcttatacatggagcaagggtaaagcaatctttgctagtggaagc
ccatttgatcctgttgaatatgaaggaaaagtttttgttcctggacaggccaacaatgct
tacatatttcctggttttggcttgggtttgatcatttctggtgcaatccgcgtgcgtgat
gagatgctcttggcagcctctgaagctttggctgcacaagtatcacaggagaactatgat
aaggggctgatttaccctccattctcaaacatcagaaagatatcagcccacattgctgct
aaagtcgcaactaaggcatatgatctaggtctggcttctcatctgcctcgacctaaggat
cttgtcaaatatgcagaaagttgcatgtacagcccaggctaccgtagctaccgttga

DBGET integrated database retrieval system