KEGG   Glycine soja (wild soybean): 114419959Help
Entry
114419959         CDS       T06057                                 

Definition
(RefSeq) probable enoyl-CoA hydratase 1, peroxisomal
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00071  Fatty acid degradation
gsj00280  Valine, leucine and isoleucine degradation
gsj00310  Lysine degradation
gsj00360  Phenylalanine metabolism
gsj00380  Tryptophan metabolism
gsj00410  beta-Alanine metabolism
gsj00640  Propanoate metabolism
gsj00650  Butanoate metabolism
gsj00903  Limonene and pinene degradation
gsj01100  Metabolic pathways
gsj01110  Biosynthesis of secondary metabolites
gsj01212  Fatty acid metabolism
Module
gsj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    114419959
   00650 Butanoate metabolism
    114419959
  09103 Lipid metabolism
   00071 Fatty acid degradation
    114419959
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    114419959
   00310 Lysine degradation
    114419959
   00360 Phenylalanine metabolism
    114419959
   00380 Tryptophan metabolism
    114419959
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    114419959
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    114419959
Enzymes [BR:gsj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     114419959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 114419959
NCBI-ProteinID: XP_028241588
LinkDB All DBs
Position
7
AA seq 278 aa AA seqDB search
MLISRSVQDRFGSNMDGKSPEKLILVNREPNGVALVTINRPGSLNSLTRPMMVDLAQAFK
RLDRDELVRVIILTGSGRSFCSGVDLTAAEDVFKGDVKDPESDPVVQMELCRKPIIGAIR
GFAVTAGFEIALACDILVAAKGSKFMDTHARFGIFPSWGLSQKLSRVIGANKAREVSLSA
TPLTAEVAEKLGFVNHVVEEGELLKKSREIADAIVKNNQDLVLRYKAVINDGLKLDLGHA
LSLEKERAHNYYNGMTKEQFKKMQEFIAGRSSKKQSKL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcttatctctcgaagcgtgcaagatcgattcgggtcgaacatggatgggaaatcgccg
gagaaactaatactggtgaaccgcgagccaaacggcgtcgcactggtgacgattaaccgt
cccggttcccttaactcgctgacccggcccatgatggtggacctggcccaggctttcaag
aggctcgaccgggacgagttggtgcgggtcattatattaaccgggtcgggccggtcattc
tgttcgggcgtggatctcacggccgctgaggacgtgttcaagggcgatgtgaaggacccg
gagagcgatccggtggtgcaaatggagctctgccgcaagccaattatcggagccatcaga
ggattcgccgtcactgctggcttcgaaattgccctcgcctgtgacatcttggttgctgcc
aagggatctaagttcatggatactcatgctaggtttgggatatttccttcgtggggtttg
tctcagaagctttcgcgcgtcataggggccaataaagcccgcgaggtatctctctcagcc
acacctttgactgcagaggtagctgagaagttgggtttcgtgaaccatgttgttgaagag
ggtgaattgttgaagaaaagcagggaaattgcggatgccattgtgaaaaataaccaagac
ttggtgttgaggtacaaggcggtcatcaatgatggcctcaagctggatcttggccatgca
ctttcccttgaaaaggagagggctcataattattataatggaatgacgaaggagcaattc
aagaagatgcaggaattcatagctggtcgaagttccaagaaacagtccaaattgtag

DBGET integrated database retrieval system