KEGG   Glycine soja (wild soybean): 114424757Help
Entry
114424757         CDS       T06057                                 

Definition
(RefSeq) uncharacterized protein LOC114424757
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00061  Fatty acid biosynthesis
gsj00780  Biotin metabolism
gsj01100  Metabolic pathways
gsj01212  Fatty acid metabolism
Module
gsj_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    114424757
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    114424757
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gsj01004]
    114424757
Enzymes [BR:gsj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     114424757
Lipid biosynthesis proteins [BR:gsj01004]
 Fatty acid synthase
  Component type
   114424757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-GeneID: 114424757
NCBI-ProteinID: XP_028247391
LinkDB All DBs
Position
8
AA seq 213 aa AA seqDB search
MTTTVSALSNTFFISQISQLEISASGYPVEENNLLQHFLDSLQSSPSIFLPTWFSCFAIV
AGYPAFPTSLDINKIRDILPHRFPFLLVDRVIEHNPGVSAVAIKNVTINDNFFPGHFPER
PIMPGVLLVEAMAQVGGLVMLQPEIGGSRNNFFFAGIDKVRFRKPVIAGDTLVMRMTLIK
LQKRFGIAKMEGKAYVGGEVVCEGEFLMATGSE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacagtctctgcactctccaacaccttcttcatctctcagatttcccagctc
gagatttcagcctctggctacccagttgaggaaaacaacctgctacaacattttttggac
tctcttcagtcttcaccttccattttcttacccacgtggttttcgtgttttgccattgtt
gctgggtaccctgcgtttccaacatcattggacatcaataagattcgtgacattctgccg
cacaggtttccatttcttctagtggatagagtgattgaacacaatcctggagtttctgca
gtggccataaagaatgtgacaataaatgacaacttttttcctgggcattttcctgaaaga
ccaatcatgcctggtgttctcctggttgaggcaatggcacaggttggtggcttggttatg
ttgcaacctgaaattggaggttctcgcaataatttcttctttgctggaatagacaaagtg
cgatttaggaagccagtgattgcaggagacactttagttatgagaatgacacttatcaaa
ctgcaaaagcgatttggaatagcaaagatggaagggaaggcatatgttggaggtgaagtt
gtgtgtgagggtgagtttctgatggcaactgggagcgaataa

DBGET integrated database retrieval system