KEGG   Geobacter sulfurreducens KN400: KN400_0339Help
Entry
KN400_0339        CDS       T01940                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00500  Starch and sucrose metabolism
gsk01100  Metabolic pathways
gsk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KN400_0339
Enzymes [BR:gsk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     KN400_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: ADI83202
LinkDB All DBs
Position
complement(369010..371574)
Genome map
AA seq 854 aa AA seqDB search
MDFTKRIHRFTVVPSLSGELAILQTLAYNLWWTWEPDAVELFKRLDIDLWQQTRHNPVEM
LGILQQTTLERLVADEGFMAQLKRVEEKYHGYMTGKTWFDRTWNGERPLRVAYFSMEFGL
HESVPTYSGGLGVLAGDHLKSASDLGIPLVGIGLLYRQGYFRQYLNIEGWQQELYPENDF
YNLPLKLQRDEEGQPVTIELDLAGRKVHVQIWKVQVGRIPLYLLDTNMEENDPLDREITA
QLYGGDQDMRIRQEILLGIGGIRALNRLGIDPNVCHMNEGHAAFLALERTKLLMEKHGLR
FPEAMEAVRAGTIFTTHTPVDAGIDHFPADLLERYLGRYYRFLGLSRDEFLSLGRQLPKN
PHESFCMAVLALRLANHANGVSQLHGEVSRKMWKNLWPELPDEHIPITSVTNGVHTKTWL
SVEMAGLLTRYLGNRWREDPTDSLLWKRVANIPDSELWRTHERCRERLVVFARRRLKDHL
HQVGATAKEIAQADEVLDPEALTIGFARRFATYKRGTLLFRDLDRLARILNDADRPVQII
FSGKAHPHDVEGKELIRRIFQHSLEARFHNRIVFIEDYDMAVARHLVQGVDVWLNTPLRP
LEASGTSGMKVAFNGGLNMSVLDGWWPEGYRGNNGWAIGKGEVYDDIDFQNEVESRAIYD
LLEKEVIPLFYDRGPDGIPRGWLACMKASLQTLCPVFSTERMVKEYAERMYLPSFEEWRT
LAGDGLARAVDLARWKGEMHRSWHQVKVISVEAPAPEEVPLGAPIPVTARIALGDIVPDR
VIVETYCGVLDSRGNIVGGELIPLDHAEEEGGGSHRFTGDIETRFCGRHGFMIRVMPRHP
ELGPVYEQGLLVWG
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggacttcaccaagagaatccaccgtttcaccgttgtcccttccctgtcgggggaactc
gccatcctccagaccctggcctacaatctctggtggacgtgggagcctgatgcggtggaa
ctcttcaagcggctcgacatcgacctgtggcagcagactcgccacaacccggtggagatg
ctcggcatcctccagcaaaccacccttgagcgccttgtggcggacgagggcttcatggcc
cagctcaagcgggtcgaggaaaaataccacggctacatgaccggcaagacgtggttcgat
cggacctggaacggcgagcgtcccctgcgggttgcctatttctccatggagttcggtctc
cacgaatcggttcccacctactccggcggcctgggggtgctggcgggggatcatctcaag
tcggccagcgacctgggaatccccctggtggggatcggcctcctctaccgccagggctac
ttccgccagtatctcaatatcgaagggtggcagcaggagctctaccccgagaacgacttc
tacaacctccccctcaaactccagcgggacgaggaagggcaaccggtcaccatcgagctc
gatctggccggccgcaaggtccacgtccagatctggaaggtgcaggtgggccggattccc
ctctatctcctggacaccaacatggaggagaacgacccgctggaccgggagatcacggcc
cagctctacggcggggaccaggacatgcgcatccgccaggagattctgctgggcatcggc
ggcatccgggcgttgaaccgcctcggcatcgatcccaatgtctgccacatgaacgagggg
cacgccgccttcctggccctggagcggaccaagctcctcatggaaaagcacggcctgcgc
ttcccggaggccatggaagcggtccgcgccggcaccatctttacgacccatactcccgtg
gacgcgggtatcgaccatttccccgcagacctgctggaacgctatctgggacgctattac
cggttcctggggctctcccgggatgaattcctctccctgggacgccagctgccgaaaaat
ccccacgaatcgttctgcatggcggtgctggccctgcggctggccaatcacgccaacggc
gtcagccagcttcacggcgaggtctcgcgcaagatgtggaaaaacctctggcccgagctg
cctgacgagcacatccccatcacctccgtcaccaacggcgtccacaccaagacctggctc
tcggtggagatggccgggctcctcacccgctacctgggcaaccgctggcgggaagacccc
accgactcgctcctctggaagcgggtcgccaacattcccgactccgaactctggcggact
cacgaacggtgccgcgaacggctggtggtctttgcccggcgccggctcaaggatcacctg
caccaggtgggcgccacggccaaggagatcgcccaggccgacgaggtgctggacccggaa
gccctgaccatcgggttcgcgcggcgcttcgccacctacaagcgggggaccctgctcttc
cgggacctggaccggctcgcccgcatcctcaacgacgccgaccgccccgtgcagatcatc
ttctcgggcaaggcccatccccacgacgtggagggcaaggaactgatccgccgcatcttc
cagcactccctggaagcgcgattccacaaccggatcgtgttcatcgaggactatgacatg
gccgtggcccggcacttggtccagggggtcgacgtctggctcaacacccccctgcgcccc
ctggaggccagcggcaccagcggcatgaaggtggcgttcaacggcggcctcaacatgagc
gttctggacggctggtggcccgagggataccgggggaacaacggctgggctatcggcaag
ggtgaggtctacgacgacatcgacttccagaacgaggtggagagccgcgccatctacgac
ctgctggaaaaggaggtcatccccctcttctatgaccggggtcccgacggcatcccccgc
ggctggctcgcctgcatgaaagcgagcctccagaccctgtgcccggtcttcagcaccgag
cggatggtcaaggagtatgccgagcggatgtacctcccctccttcgaggagtggcgcacc
ctggccggcgacggtctggcccgggccgtggatctggcccgctggaagggtgagatgcac
cggtcctggcaccaagtgaaagtgatttcggtggaggcccccgcccccgaggaggtgccc
ctgggcgcgcccattccggtgactgcccgtattgccctgggcgacatcgtcccggaccgg
gtgattgtggagacctactgcggcgtcctcgactcccggggcaacatcgtgggaggcgag
ttgattccgctggaccacgcggaagaggaagggggaggctcccaccgcttcacgggtgac
atcgaaacccggttctgcggcaggcacggtttcatgatccgggtcatgccccgccatccc
gaactgggaccggtttacgaacagggtctgctcgtctggggctga

DBGET integrated database retrieval system