KEGG   Geobacter sulfurreducens KN400: KN400_0765Help
Entry
KN400_0765        CDS       T01940                                 

Gene name
hybL
Definition
(GenBank) periplasmically oriented, membrane-bound [NiFe]-hydrogenase, large subunit
  KO
K06281  hydrogenase large subunit [EC:1.12.99.6]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00633  Nitrotoluene degradation
gsk01120  Microbial metabolism in diverse environments
gsk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gsk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    KN400_0765 (hybL)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KN400_0765 (hybL)
Enzymes [BR:gsk01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With unknown physiological acceptors
    1.12.99.6  hydrogenase (acceptor)
     KN400_0765 (hybL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NiFeSe_Hases
Motif
Other DBs
NCBI-ProteinID: ADI83628
LinkDB All DBs
Position
821852..823534
Genome map
AA seq 560 aa AA seqDB search
MSKRITIDPITRIEGHLRIDVEVNGGQVAKAWSSAQMWRGIETILKGRDPQDAWSYAQRF
CGVCTTVHAISSIRSVENALNVEVPLNAQYIRNIMIAQHSVQDHIVHFYHLSALDWVDIV
SALKADPKKASSIAQSLSDWPGNSEKEFKAVQDKLKAFVASGQLGIFASGYWGHPAMKLP
PEVNLIAVAHYLKALDYQRRASQAVAILGGKNPHVQNLVVGGVATAVNMENIATLNMERI
AFLRTLMEETREFVQKVYYPDLVAIASFYKEWFKYGAGVTNYLAVPEFAEDTRNTKFGLP
GGTIYGGDLGTFKAITTHQDAALIQGVTEGVAHAWYEGSDSLHPWEGETKPQYTDFQENG
KYTWCKSPRYNGKPMQVGPPAQVMAAYATGHPKVKKLVDDAAAKLGIGPKELHSTMGRLF
CRGVRAHVMADYSLEYLDKLVANIGKGDSTYANHTEIPDGEYKGVGFHEAPRGALSHWIV
IEKKKIKNYQAVVPSTWNASPRDENGVAGPYEACLVGNPVAQPDKPLEVLRTIHSFDPCI
ACAVHTIDPAGKEITKVKVL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacgtatcaccatagaccccatcacccggatcgagggtcacctgagaatcgat
gtggaagtgaatggcggccaggttgccaaggcctggtcctcggcccagatgtggcggggc
atcgagaccatcctcaaggggcgcgatccccaggacgcctggtcctacgcccagcgtttc
tgcggcgtctgcactacggtgcacgccatctcgtccatccgttccgtggagaacgccctg
aacgtggaagttcccctcaacgcccagtacatccgcaatatcatgatcgcccagcactcg
gtgcaggatcacatcgtccacttctaccacctgtccgccctggactgggtcgacatcgtg
tccgccctgaaggccgacccgaagaaggcctcctccatcgcccagagcctgtccgactgg
cccggcaacagcgagaaggagttcaaggcggtccaggacaagctcaaggcgttcgtggcc
agcggccagctcggcatcttcgcctccggctactggggccatccggccatgaagctgccg
cccgaggtgaacctgatcgccgtggcccactacctcaaggctctcgactaccagcgccgg
gcttcacaggctgtggccattctcggcggcaagaacccccacgttcagaacctggtggtg
ggcggggtagccaccgctgtgaacatggagaacatcgccaccctcaacatggagcggatc
gccttcctccgcacccttatggaagagacccgcgagttcgtccagaaggtctactacccg
gacctggtggccatcgcttccttctacaaggaatggttcaagtacggcgccggcgtcacc
aactacctggcggtccccgagttcgccgaagacacccgcaacaccaagttcggcctcccc
ggcggcaccatctacggcggcgatctgggtaccttcaaggcgatcaccacccaccaggat
gcggcgctcattcagggggtcaccgaaggggtggctcacgcctggtacgaaggctccgat
tcgctccacccctgggaaggggagaccaagccccagtacaccgacttccaggagaacggc
aagtacacctggtgcaagtcgccgcgctacaacggcaagcccatgcaggttggaccgccc
gcccaggtcatggccgcctacgccaccggccatcccaaggtcaagaagctggtggacgac
gccgcagccaagctcggcatcggtcccaaggagctccactccaccatgggccggctcttc
tgccggggcgtgcgcgcccacgtcatggccgactactccctggagtacctggacaagctc
gtggccaacatcggtaagggtgactccacctacgccaaccacacggaaatccccgacggc
gagtacaagggggtcggcttccacgaggcgccccgtggtgccctgtcccactggatagtc
atcgagaagaagaagatcaagaactaccaggccgtggttccgtccacctggaacgcctcg
ccgcgggacgagaacggcgttgccggtccctacgaagcctgcctcgtgggcaaccccgtg
gctcagccggacaagccgctggaagtgctgcgcaccatccactccttcgacccctgcatt
gcgtgcgccgtccacaccatcgacccggccggcaaggagatcaccaaggtcaaggtcctg
taa

DBGET integrated database retrieval system