KEGG   Geobacter sulfurreducens KN400: KN400_1732Help
Entry
KN400_1732        CDS       T01940                                 

Definition
(GenBank) pyridoxal-5'-phosphate-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00250  Alanine, aspartate and glutamate metabolism
gsk00410  beta-Alanine metabolism
gsk00430  Taurine and hypotaurine metabolism
gsk00650  Butanoate metabolism
gsk01100  Metabolic pathways
gsk01110  Biosynthesis of secondary metabolites
gsk01120  Microbial metabolism in diverse environments
gsk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gsk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KN400_1732
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KN400_1732
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KN400_1732
   00430 Taurine and hypotaurine metabolism
    KN400_1732
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    KN400_1732
Enzymes [BR:gsk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     KN400_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADI84544
LinkDB All DBs
Position
1840050..1841708
Genome map
AA seq 552 aa AA seqDB search
MPKNRDAARASLENLYRIFTVPEAPDSTLGAIDQAISGDVTGFLQTHIVAIERDLEDIEA
NFSSFSIPEEPTYVSEYTEFVKENLVAHSVHTASPAFVGHMTSALPYFMLPLARLMTALN
QNVVKVETSKAFTPMERQVLAMLHHLVYRRDEDFYPSWIHNSRHALGAFCSGGTIANITA
LWVARNRLFAPNGAFRGIAQEGLARALKHRGADGIAVLVSERGHYSLGKATDLLGIGRDD
LVKVKTDANNRIDLKALREECRRFQDRNTLPLALVGIAGTTETGNVDPLEAMADLAQELG
CHFHVDAAWGGPTLFSDRHRSLLKGIERADSVTIDGHKQLYVPMGAGMVVFKDPTALSAI
EHHANYILRHGSKDLGSHTLEGSRPGKAMLVHAGFSIIGRKGYELLIDMGIERARTFADM
IKQHPDFELISEPELNILTYRYCPAAVQQTLHDVTDRERADINALLDLVCQLLQKFQREA
GKTFVSRTRLHVARHDRELTVLRVVLANPLTTDEILESVLAEQCELVQLPEIQAVLQQVE
ELCTGLAKAASW
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaaatcgtgacgcagctcgtgccagccttgagaacctctaccggatcttcacc
gtgcctgaagcacccgactcgaccctcggcgctatcgatcaggcgatttccggcgatgtt
accggtttcctgcagacccatatcgtcgccatcgagcgtgatctggaagatatcgaagca
aatttctcttccttctccattccggaagaaccgacctacgtttccgaatacaccgaattc
gtcaaagagaacctcgtcgcccactcggtccataccgcttcgccggcgttcgtcggtcac
atgacctcggcgctcccgtacttcatgctgccgctggcgcgtctcatgaccgccctcaac
cagaacgtggtcaaggtggagacatccaaggcctttacaccgatggaacggcaggtcctt
gccatgcttcaccacttggtctatcgccgcgacgaggacttctacccatcatggattcat
aacagccggcatgctctgggggccttttgttccggcggtaccatcgccaatattacggcc
ctgtgggtggcacgcaaccgcctgtttgccccgaacggagcatttcgcggcattgcccag
gaggggctggcccgtgcgcttaagcatcgcggcgcggacggcattgccgtgctcgtctcc
gaacgggggcactactccctgggaaaggcgaccgacctgctcggcattggccgggacgat
ctggtcaaggtgaaaaccgacgcgaacaaccgcattgacctcaaggcactgagagaagag
tgccggcgcttccaggaccggaacacgctcccgctggcactggtcggcatcgccggaacc
accgaaaccggcaacgtggaccctctggaggcgatggccgatcttgctcaggaacttggc
tgccatttccatgtggatgccgcgtggggtggaccgaccctcttttcggatcgccaccgc
tctctgcttaagggtatcgagcgagccgactcggtcaccattgacgggcataagcagctc
tatgtgccgatgggggcgggaatggtcgtcttcaaggatcccaccgccctgtcggccatc
gagcatcacgccaactatatcctgcgccacggttccaaggacctgggcagccataccctg
gagggatcacggccggggaaggcgatgttggtacatgccggtttctcgatcattggacgc
aaagggtacgaactgctgatcgacatggggatcgaacgtgctcgcacctttgccgacatg
atcaagcagcatcccgatttcgaactgatcagcgaaccggaactgaatatccttacttat
cgctactgcccggccgccgttcagcagaccttgcacgacgtgacggaccgggaacgcgcc
gatatcaatgcactcctcgatctggtctgccagttgctgcagaaattccagcgcgaagcc
gggaaaacatttgtctcccggacacggctgcatgtggcgcgccatgatcgggaactcacc
gtgctgcgcgtcgtcctggccaacccgctgacaactgacgagattctggagtccgtactg
gcggagcagtgtgaactcgtgcaactgccggagattcaggcagtgctgcagcaggtggaa
gagctctgtaccggcttggcaaaagcagcttcatggtag

DBGET integrated database retrieval system