KEGG   Geobacter sulfurreducens KN400: KN400_2211Help
Entry
KN400_2211        CDS       T01940                                 

Gene name
fabZ-2
Definition
(GenBank) (3R)-hydroxyacyl-(acyl carrier protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00061  Fatty acid biosynthesis
gsk00780  Biotin metabolism
gsk01100  Metabolic pathways
gsk01212  Fatty acid metabolism
Module
gsk_M00083  Fatty acid biosynthesis, elongation
gsk_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:gsk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KN400_2211 (fabZ-2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KN400_2211 (fabZ-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gsk01004]
    KN400_2211 (fabZ-2)
Enzymes [BR:gsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     KN400_2211 (fabZ-2)
Lipid biosynthesis proteins [BR:gsk01004]
 Fatty acid synthase
  Component type
   KN400_2211 (fabZ-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: ADI85023
LinkDB All DBs
Position
complement(2372776..2373228)
Genome map
AA seq 150 aa AA seqDB search
METVFDINEIMKILPHRYPFLLVDRIVEYVAGERIVGIKNVSINEPFFQGHFPGHPVMPG
VLIVEAMAQVGGIYAYVTLGDEVRDKVCYFASIDNVKFRKPVVPGDQLRIEVTISGCKRG
IWCFSARATVNGKLVTEAELKATFADKEKL
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagtctttgatatcaacgaaatcatgaagattcttccccaccgctaccccttc
ctcctggtggatcggattgtggagtacgttgccggcgagcggatcgtggggatcaagaac
gtcagcatcaatgagccgtttttccaaggccactttccgggacacccggtgatgccggga
gtcctgatcgttgaggccatggcccaggtggggggaatctacgcctatgtgaccttgggc
gacgaggtccgcgacaaggtctgctactttgcctccatcgacaacgtcaagttccgcaaa
ccggtggtgccgggagaccaactgcggatcgaagtaacgatctccggttgcaagcggggc
atctggtgcttcagcgccagggccaccgtgaacggcaagctggtcaccgaggcggagctc
aaggcgacctttgccgacaaggaaaaactctaa

DBGET integrated database retrieval system