KEGG   Geobacter sulfurreducens KN400: KN400_2384Help
Entry
KN400_2384        CDS       T01940                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex, E2 protein, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00010  Glycolysis / Gluconeogenesis
gsk00020  Citrate cycle (TCA cycle)
gsk00620  Pyruvate metabolism
gsk01100  Metabolic pathways
gsk01110  Biosynthesis of secondary metabolites
gsk01120  Microbial metabolism in diverse environments
gsk01130  Biosynthesis of antibiotics
gsk01200  Carbon metabolism
Module
gsk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gsk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KN400_2384 (aceF)
   00020 Citrate cycle (TCA cycle)
    KN400_2384 (aceF)
   00620 Pyruvate metabolism
    KN400_2384 (aceF)
Enzymes [BR:gsk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KN400_2384 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 TYW3
Motif
Other DBs
NCBI-ProteinID: ADI85196
LinkDB All DBs
Position
complement(2572059..2573315)
Genome map
AA seq 418 aa AA seqDB search
MATDITMPKLSDTMTEGRLVAWKKGVGDPVERGDIIAEVETDKATMELEAFASGVLAEQR
VKPGELVNVGTVIGVIGGADEVKPTEKAAAAPPELADWQPPPGEPANGAEPEIPERVLEL
PEASAPPAPLPPGDDTKASPAVRRLAREKGIDLHQVRGSGPEGRILMEDLDQVAANEEPP
AAQAGQASAGESPAPPEAEPLTRMRGAIARITAEAWRTIPHFYETVEIDMKEAGEIVREL
KGGGNAVTYNDLVLKAAALALVQFPRMNASFRDGGVVAHREVNIGFAVAMEEGLQVPVVK
GCQSLALKEIALQTVRLAERARSGAITQEEISGGTFSVSNLGMYGIDEFAAVIMPPQAAI
LAVGAVADRPVVRDGQLAVARTMRATLSCDHRVVDGAYAAQFLGELRRVLENPVLMLV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgacatcaccatgcccaagctctccgacaccatgaccgaaggccgtctcgtc
gcctggaagaaaggggtgggcgacccggtggagcggggcgacatcatcgccgaggtggag
accgacaaggccaccatggagctggaggcgttcgcctcgggcgttctggcggagcagcgg
gtgaagcccggcgagctggtgaacgtgggcacggttatcggcgtgatcggcggggcggat
gaggttaagccgacggagaaggccgcagccgcccccccggagctggccgactggcagccg
ccaccgggggaaccggcgaacggggcggagcctgagatcccggagcgggtgctggagttg
cccgaagcatcggcgccgccggctcccctgccgccgggcgacgataccaaggcctctccc
gccgtgcgccgcctagcgcgcgagaagggcatcgacctgcaccaggtgagggggagcggc
cccgaggggcgcattctgatggaggacctggatcaggttgcggcgaatgaggagcccccg
gcggcgcaggcagggcaggcttctgcgggcgaatctcccgctccgcccgaggccgagccc
ctgacgcggatgcggggcgccatcgcccggatcacggccgaggcgtggcgcaccatcccc
catttctacgaaaccgtcgagatcgacatgaaggaggccggtgagatcgtccgggaactg
aaggggggcggcaacgccgtgacctacaacgacctggtgctcaaggccgctgccctggcc
ctggtgcagtttccccggatgaacgcctcgttccgggacggaggtgtcgttgctcaccgg
gaggtgaacatcggctttgccgtggccatggaggaggggctgcaggtgccggtggtgaag
gggtgtcagtcgctggccctgaaggagatcgccctccagaccgtgcgcctggccgagcgg
gcccggagcggcgccatcacccaggaggagatttccggcggcaccttcagcgtttcgaac
ctggggatgtacggcatcgatgagtttgccgccgtgatcatgccgccccaggcagcgatc
ctggccgtgggtgccgtggcggaccggcccgtggtgcgggatgggcagctggcggtcgcc
cggaccatgcgggcgaccctttcctgcgaccatcgggtggtggacggggcctatgcggcc
caattcctgggcgaattgcggagggtgctggagaatccggtgctgatgctggtatga

DBGET integrated database retrieval system