KEGG   Geobacter sulfurreducens KN400: KN400_2701Help
Entry
KN400_2701        CDS       T01940                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase, FAD-dependent
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00564  Glycerophospholipid metabolism
gsk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KN400_2701 (glpA)
Enzymes [BR:gsk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KN400_2701 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 GIDA Pyr_redox_3 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ADI85513
LinkDB All DBs
Position
complement(2936203..2937756)
Genome map
AA seq 517 aa AA seqDB search
MKREDLLRHLTETDVWDLIVIGGGATGLGTAVEAAGRGYRTLLLEQGDFAQGTSSRSTKL
IHGGVRYLQQGNLSLVLEALRERGLLIRNAPHLVHNLSFVVPLYDWWEGPFYGIGLKLYD
VLAGKLGLGPSRLLSREETLGHIPTVEPHGLRGGVIYHDGQFDDSRLAISLALTLADLGG
VALNHFPVTGIISRDGLVAGVEARDRETGGAFRIMGRAVINAAGPFVDGVRRLADPAARD
LIAPSQGVHLVLDGSFLPGDSAIMVPHTDDGRVLFAVPWHGRTVVGTTDTPIPAAGLEPR
PLPEEIDFLLSHAARYLTRHPERRDVLSTFAGIRPLVRSDSGGDTASLSRDHTLLVEGSG
LVTIAGGKWTTYRKMGEDTVTAAAQVAGLDHRPSVTETLRIHGWQEDATEGPLQVYGSDA
AALEQLLQENAAWREPLHPALPYCAGEVVWGVRHEWARTVEDVLARRTRALLLDARAAVA
AAPRVAELMARELGRDSDWQAAQVAAFTHLARGYLPE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgaggatctgctgcggcacctgaccgagaccgatgtctgggacctgatcgtg
atcggcgggggcgccacgggcctcggcacggcggtggaggcggccgggcgcggctaccgg
acccttctccttgaacagggggactttgcccaggggacctccagccggagcaccaagctg
atccacggcggggtccgctacctgcagcagggcaacctttcgctggtgctggaggcgctg
cgggagcggggcctgctcatccgcaacgcaccgcacctggtccacaacctttcctttgtg
gtgccgctctacgactggtgggaagggcccttctacgggatcgggctcaagctgtacgac
gtcctggccggcaagctggggctggggccgtcccgcctgctgtcgcgggaagagaccctg
ggccacatcccgaccgtggagccccacggcctgcgcggcggggtgatctaccacgacggc
cagttcgacgactcccgcctcgcgatcagcctggccctgaccctggccgacctgggcggg
gtggcgctcaatcacttcccggtgaccggcatcatcagccgcgacggtctcgtggccggg
gtggaggcgcgggaccgggagaccggcggcgccttcaggatcatggggcgggcggtgatc
aatgccgccggacctttcgtggacggggtgcggcggctggccgacccggcggcccgggac
ctcatcgccccgagccagggggtgcacctggtgctggacggctcgtttctgcccggcgac
agcgcgatcatggttccccacaccgacgacgggcgcgtcttgtttgcggtcccctggcac
ggccggaccgtggtgggcaccaccgatacgccgatcccggcggccgggctggagccgcgc
ccgctgccggaagagatcgactttctcctgtcccatgcggcccgctacctgacccggcat
cccgaacgccgtgacgtgttgagcaccttcgccggcatccggcccctggtccgcagcgac
agcggcggcgacaccgcctccctttcccgggaccacaccctgctggtggagggaagcggc
ctggtcaccattgccggcggcaagtggaccacctaccggaagatgggggaggacacggtt
accgccgctgcccaggtggccggcctggaccatcggccgtcggtcacggagacgttgcgt
atccacggctggcaggaggatgcgacggagggaccgctgcaggtctacggcagcgatgcc
gcagccctggagcaactcctgcaggaaaacgccgcctggcgtgagcccctgcacccggcg
ctcccctactgcgccggggaggtcgtctggggggtgcgtcacgagtgggcccgcacggtg
gaggatgtcctggcccgccgcaccagggcgctgctgctggatgcccgtgccgccgtggcc
gcggcgccgcgggtggcggagctgatggcgcgggagctgggacgggacagcgactggcag
gcggcgcaggttgccgcgtttacccatctggcccggggctacctgccggagtga

DBGET integrated database retrieval system