KEGG   Geobacter sulfurreducens KN400: KN400_3005Help
Entry
KN400_3005        CDS       T01940                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00473  D-Alanine metabolism
gsk00550  Peptidoglycan biosynthesis
gsk01100  Metabolic pathways
gsk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gsk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KN400_3005 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KN400_3005 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    KN400_3005 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gsk01011]
    KN400_3005 (ddl)
Enzymes [BR:gsk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KN400_3005 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:gsk01011]
 Precursor biosynthesis
  Amino acid ligase
   KN400_3005 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATP-grasp_3 RimK GARS_A ATP-grasp_5 ATPgrasp_Ter ATPgrasp_ST TTL
Motif
Other DBs
NCBI-ProteinID: ADI85817
LinkDB All DBs
Position
complement(3265262..3266212)
Genome map
AA seq 316 aa AA seqDB search
MTRDELKTRKIGVLMGGLSAEREVSLASGGAVLNALQSRGYDAVPVDVGRDLPQVLVREW
IDVAFICLHGRYGEDGTVQGLLELMGIPYTGSGVLASALAMNKIVAKEVFAARGLTVAPY
RVVRRGEAVDPVAEGFGYPVVVKPSQEGSSVGVSIVKSPEELPYALETAFRYDDDILVER
FIKGREIQIGILDDRAMGAIEIVPVNEFYDFEAKYTAGKAEHICPPVLPAELYRRLLAEG
ETAHRALGCSGYSRVDFLVTEGGECYLLEVNTLPGMTALSLLPEIALKESGIGFEDLVER
ILISAALKIKGEGAGS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacgagggatgagctgaaaaccaggaagataggcgtacttatgggaggtctctcggct
gagcgcgaagtgtcccttgccagcggcggcgccgtgctgaatgccctccagagtcgggga
tatgacgcggtgcccgtagacgtcggccgggatctcccccaggtcctggtccgtgagtgg
atcgatgttgccttcatctgcctccacggccgctacggggaagatggaaccgtccagggg
ctgctggagctcatgggcattccttacaccggatcgggggtcctggccagcgcccttgcc
atgaacaagatcgtcgccaaggaggttttcgctgcgcgggggctcactgtcgctccctat
cgggttgtgcgccggggcgaggcagttgatcccgtggcggaagggttcggctatccggtg
gtggtgaagccgtcccaggaagggtcatcggtgggggtgagcattgtcaagtcgccggaa
gagctcccttatgccctggagactgccttccgctatgatgatgatatcctggtggagcgc
ttcatcaaggggcgcgagatccagatcgggatactggacgaccgggccatgggggccatt
gagatcgttcccgtgaacgagttctacgacttcgaggccaagtataccgcaggcaaggcc
gagcatatctgcccgccggtgctcccggcggagttgtaccgcaggctcctggccgaaggg
gaaacggctcaccgggccctgggatgctccggttacagcagagtcgatttcctcgtaacg
gaagggggcgagtgttatctcctggaggtgaacaccctgccgggaatgaccgcgttgagc
cttctgcccgagatcgccctcaaggagtccgggatcggtttcgaggacctggtggagaga
attctgatttccgctgcgctgaaaatcaagggggaaggggccggaagctag

DBGET integrated database retrieval system