KEGG   Galdieria sulphuraria: Gasu_13120Help
Entry
Gasu_13120        CDS       T02926                                 

Definition
(RefSeq) succinate dehydrogenase (ubiquinone) flavoprotein subunit isoform 1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00020  Citrate cycle (TCA cycle)
gsl00190  Oxidative phosphorylation
gsl01100  Metabolic pathways
gsl01110  Biosynthesis of secondary metabolites
gsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gasu_13120
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Gasu_13120
Enzymes [BR:gsl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Gasu_13120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 17089991
NCBI-ProteinID: XP_005707862
UniProt: M2XMF7
LinkDB All DBs
Position
Unknown
AA seq 632 aa AA seqDB search
MLHHPVFLESLTPSSIILTMVCWLVDLKNVSIDYLFQAVVVGAGGAGLRATIGLCEAGLK
AACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREA
PATVIELEHYGLPFSRTQEGKIYQRAFGGQSLKFGKGGQAFRCAAAADRTGHALLHTLYG
QALRHNATFFVEYFALDLIMDKEGVCRGVVALCLEDGTIHRFRSNATILCTGGYGKAYFS
ATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGCRGEGGYLTNSNGER
FMERYAPSAKDLASRDVVSRSMTIEIREGRGVGPLKDHIYLHLEHLPPDVIHERLPGITE
TAKIFAGVDVTKEPIPVLPTVHYNMGGIPTNWKGQVVTIKDGNPNSVVPGLYAAGEAACA
SVHGANRLGANSLLDIVVFGRACARTVADLYRPGQTQPPLPEDAGEESIARLDQYRHANG
SLKTSEIRLHMQRTMQNHASVFRVSQVLQEGCKAMNECYESLQDVKISDRSMIFNTDLVE
TLELENLLQNALITIYGAEARHESRGAHSREDYPKRDDSNWMKHTLGWISSPKQPFIAAG
QKSYVRLDYRPVISETLDAAEQESFPPAQRVY
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaccatccagtttttctggaaagtcttactccatcgtcgatcatacttacgatg
gtatgttggttggtagatttgaaaaacgtctctattgattatctgttccaagctgtggtc
gtaggtgctggaggagcaggtttaagagcaactattggactttgtgaagccggtttgaaa
gctgcttgtattaccaagttatttcccacacgttctcatacagttgccgctcaaggagga
atcaacgcagctttaggcaatatgaccgaagatgactggaggtggcatatgtacgataca
gtaaagggatccgactggttaggagatcaagatgctattcactacatgtgtcgcgaagct
ccagccacagttattgaattggaacactatgggcttccattttcaagaacacaagaaggg
aaaatatatcaacgtgcctttggtggacaatctttgaagtttgggaaaggtggtcaagcc
tttcgttgtgcagcagcagccgatagaactggacatgcattgctacatacactttatggc
caagctttaagacacaatgcgactttctttgtggagtactttgcgttggatttgattatg
gataaagaaggtgtatgtcgaggagttgttgcattatgtttggaagatggaactattcat
cgttttcgttccaatgcaactattctatgtacgggtggttatggaaaggcttatttttca
gctacttctgcacatacttgtacaggtgatggaaatgcaatggttgcaagagctggttta
cccttgcaagacttggaatttgttcagtttcatccgactggtatatatggagctggttgt
ttgattacggaaggctgtcgtggagaaggtggctacttgaccaattcgaatggagagcgc
tttatggagcggtatgccccttctgcaaaggatcttgcttcccgcgatgtagtttctcgt
tctatgacgatagaaatccgagaaggaagaggagttggacctttaaaagatcatatttat
ctccatttggaacatttacctcccgatgtgattcatgaacgcttgccagggatcacagaa
acagccaaaatttttgctggtgtggatgttacaaaggaacctattccagttcttccaaca
gtacattacaatatgggtggtattccaaccaattggaaaggacaagttgtcactataaaa
gatggaaatccaaatagtgttgttccaggtttatatgcagcaggagaagctgcatgtgct
tcggttcacggggctaatagactgggagccaattctttactagatattgtagtttttggt
agagcttgtgcccgaacagtggcagacttgtatcgacctggtcaaacgcaaccaccttta
ccggaagatgccggtgaagagtccatagcaagactggaccaatatcgtcatgcaaatgga
agccttaagactagtgaaattcgtcttcatatgcaacgaactatgcaaaatcatgcttcc
gtatttcgtgtatctcaagtgttacaagaaggttgcaaggcaatgaatgaatgttatgag
tctcttcaggacgttaagatttcagaccgttccatgatatttaataccgatttggttgag
accttagaattggaaaacttgttgcaaaatgctttgatcacaatatatggagcagaagct
cgtcatgaaagtagaggtgctcattctagagaagattatcctaagagagatgatagcaat
tggatgaaacacactctcggctggatttcttcacctaaacagccttttattgctgcagga
caaaagtcatatgtaagattggattatcgtccagtcatatcagagacattggatgccgca
gaacaagaatctttccctcctgctcagagagtctattag

DBGET integrated database retrieval system