KEGG   Galdieria sulphuraria: Gasu_14410Help
Entry
Gasu_14410        CDS       T02926                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00564  Glycerophospholipid metabolism
gsl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Gasu_14410
Enzymes [BR:gsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Gasu_14410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA 3HCDH_N NAD_binding_8 Methyltransf_34 HI0933_like
Motif
Other DBs
NCBI-GeneID: 17089861
NCBI-ProteinID: XP_005707713
UniProt: M2Y5F0
LinkDB All DBs
Position
Unknown
AA seq 635 aa AA seqDB search
MGAFRKTLLFVGGSVLVVGALGAAIIGTSSSAAPFARIDESSNNGKYAVRLPPLESVPPR
QKQLESLRSYSQEQNSLDILVIGGGATGSGVALDAALRGLSVGLVERDDFASGTSSRSTK
LIHGGVRYLEKAFFNLDPKQLGLVFEALHERAIMLRQAPHLTHPLPTILPCYQWWEVPFY
WVGLKFYDAIAAMGHGSLYLSKYYSSAEARRLFPTLSPLRADKKPLRGAIVYFDGQMNDA
RVNVSVALTAALYGAAVANHTEVTGLLKNSKNGKVNGARVRDRLTGEEFDIHARVVVNAA
GPFSDYIHHMVNPTSSDIIAPSSGVHVTLPSYYSPDGMGLIVPKTKDGRVVFMLPWLGST
IAGTTDSSTEITELPQPHEDEIAFILEAIRDYLNVQVRREDVKSAWSGIRPLARDPRAKD
TQNILRDHLVFASPEGLVTVAGGKWTTYRRMAEDTVDKAIQVGQLKPQDSCKTPYVQLIG
SHSWDPSYFTFLVQNYRRLKYTVSKSMSPSIGELDIDCAKHLSTSYGDQAYKVCELAQQG
WGKRLVHGYPVLEAEIVYCAQNEYCFTAADFLARRCRLAFLDAEAANQALPRVVEILGDI
YDWSSRKREEELEQGRRFLASFLGGRTEPRLKQVT
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgggagcctttcgcaagaccctgttgtttgttggtggtagtgtgcttgtggtgggtgcc
ttgggagcagccataataggaacctcttccagcgcagcgccattcgcaagaatcgacgaa
agctccaacaacggaaaatatgctgttcgcttgccaccgttggagagtgttcctcccaga
cagaagcagttggagagtttgcgatcttatagtcaagaacagaattcgttggatattctg
gtcattggaggaggagcaactgggtcgggagttgctcttgatgctgcccttcgtggactt
tccgttggtcttgtagagcgggacgacttcgcttcaggaacgtcttcaagaagtacaaaa
cttattcacggtggagttcgctatttagagaaagcttttttcaatttagatccaaagcag
ttgggtcttgtatttgaagcacttcatgagagagccattatgctgagacaagcacctcac
ttgacgcatccgttgccaaccattcttccttgttatcagtggtgggaagttcctttttac
tgggtaggtctgaagttttacgatgccatagccgcaatgggtcatggcagcttgtatctt
tcaaaatattattcgtctgcagaagccagaagattatttcctacactttcaccgttacga
gcagataagaaaccgttaagaggagctattgtttattttgatggtcagatgaacgacgct
agagtaaacgtttctgtagccttaactgctgcgctttatggtgctgcagttgcgaatcat
acggaggtcactggactcttgaagaattcaaaaaatggaaaggtcaatggagcaagagta
agagaccgcctaactggagaagagtttgatattcatgccagagtggttgtcaatgccgct
ggtcctttttctgactatattcatcatatggtcaatccaacatcttctgatattatcgca
ccaagttcaggagtacatgttacgttaccctcgtattattcaccagatggaatgggatta
atcgttccgaagacgaaagatggtcgggttgtttttatgcttccatggttaggttccact
atagctggaacgactgactcgtcgactgaaatcacggaactgcctcaaccacatgaagac
gagatagcatttattttagaagcaattcgtgattatttgaacgttcaagtaagaagagaa
gacgtgaagtcagcatggagtggaattagacccttagcaagagatccaagggcaaaagat
acacaaaatattttaagggatcatttggtctttgcctcgcctgaaggcctggttactgtt
gcaggtggaaaatggactacttaccgaagaatggctgaagatactgtcgataaggctatc
caagttggacagctgaagccccaagattcatgcaaaactccatatgttcaactgataggc
tctcattcttgggacccttcctatttcacttttctagtgcagaactatcgacgcctcaaa
tacacagtttccaagtcgatgagtccatccatcggcgagttggatattgattgtgcaaag
cacctgagtacttcttatggagatcaagcctataaagtatgtgaactagcacagcaggga
tgggggaagcggctagttcatggttatccagttttagaagcagaaattgtgtactgcgct
caaaacgaatattgttttacagcagctgattttcttgcaagaagatgccgtttggcgttt
ttagatgctgaagcagcgaaccaggctttaccgcgtgttgtagaaattcttggagatatt
tacgattggagcagcaggaaacgggaagaagagttagaacaaggaagaagatttcttgcc
tctttccttgggggaagaacagaaccgagattgaagcaggttacatga

DBGET integrated database retrieval system