KEGG   Galdieria sulphuraria: Gasu_16100Help
Entry
Gasu_16100        CDS       T02926                                 

Definition
(RefSeq) glutamate decarboxylase isoform 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00250  Alanine, aspartate and glutamate metabolism
gsl00410  beta-Alanine metabolism
gsl00430  Taurine and hypotaurine metabolism
gsl00650  Butanoate metabolism
gsl01100  Metabolic pathways
gsl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Gasu_16100
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gasu_16100
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gasu_16100
   00430 Taurine and hypotaurine metabolism
    Gasu_16100
Enzymes [BR:gsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Gasu_16100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 17089787
NCBI-ProteinID: XP_005707630
UniProt: M2X3V7
LinkDB All DBs
Position
Unknown
AA seq 492 aa AA seqDB search
MPLHPVHSKPSQQKDNEDSLCGSVFASRYMSKPIPTYRMPEEAMPPEVAYQLIHEELALD
GNPQLNLASFVTVWMEPQADRLMTENIGKNFIDLEEYPCTAELQKRCVNMIAHLFHVPTE
QGQSDSVGTATVGSSEAIMLAGLAFKWRWKQARKQAGLSTEKPNLVMGSNVQVCWEKFCR
YFEVEARYVPVSENLLIMEPEKAMSYVDENTIGVCSILGSTYNGAFEDVKKLNDCLCKLN
EEKGWNVPIHVDAASGGFIAPFLYPDLVWDFRLPLVRSINVSGHKYGLVYPGVGWVVWKS
QEDLPQDLIFHVNYLGADQATFTLNFSKGAGQIVAQYYQFIPMGQNGYRAVLSNLQKICQ
YLRKKVEESGRFRVYSDEVSVPLVAFGLKEPQAYDEFDISHRLKEYGWIVPAYNFPPKAE
HIKVLRVVIRETFSRDLCDMLWRDLMWTLEELDRKTPDSIRHGRELLMEKNRQKHKAFAH
VKSQKQKTNGVC
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcctctccatccagtacactcgaagccttctcaacaaaaggataatgaagactcacta
tgtggatcagtatttgcttcaagatacatgtcaaagcctatacctacatatcgcatgcct
gaggaagccatgccaccagaagtggcttaccagttgattcacgaagaattggcactcgac
gggaatccacagttgaacttggcgtcttttgtgaccgtatggatggagccccaagcagac
cgtcttatgactgaaaatattggtaaaaattttattgacttggaagaatacccttgtact
gcagagttacaaaagcgttgtgtcaatatgattgcacacctctttcacgtacctacagaa
caaggtcaatcggactctgtaggcacagctacagtagggagttcagaagcaatcatgttg
gctggtttggctttcaagtggcgatggaaacaagcaagaaaacaagcgggattgtcaaca
gaaaaacccaatcttgtgatgggatccaatgtgcaagtatgttgggagaagttttgtcgc
tattttgaagtagaagcacgttatgtaccggtatcggagaatcttttgattatggaacca
gaaaaagccatgtcctatgtggatgagaataccatcggtgtttgcagcattcttggaagc
acatataatggtgcatttgaagatgtgaaaaaactaaatgactgcctttgcaagttgaat
gaagaaaaaggttggaacgttcctattcatgtggatgcagcttctggtggttttattgca
ccttttctttatcctgatttggtttgggactttcgtcttcctctcgtacgttccatcaat
gtttctggacataaatatggccttgtgtatcctggtgtgggatgggttgtatggaagagt
caagaggatttaccacaagatttgatatttcatgtaaactatttgggagcagatcaagct
acatttactctcaacttttcaaaaggagcgggtcagatagtagcacagtattatcaattc
attcccatgggacaaaatggatatagagctgtgttaagtaaccttcaaaagatatgtcag
tatttgagaaagaaagttgaagagagtggacgctttagagtttatagtgatgaagtgagc
gtacctttggttgcctttggtttaaaagaacctcaagcatatgatgaatttgatatctca
catcgtctaaaggaatatggctggatcgttccagcatataattttcctcccaaggctgaa
catatcaaagttcttcgagtagtgattcgtgaaactttttctagagatttatgtgatatg
ttatggagagacttgatgtggacgttggaggaattggacagaaaaactcccgactctata
cgtcacggcagagaattgctgatggaaaagaatcgacaaaagcacaaagcatttgctcac
gtgaaaagtcaaaaacaaaaaaccaatggagtctgttag

DBGET integrated database retrieval system