KEGG   Galdieria sulphuraria: Gasu_16620Help
Entry
Gasu_16620        CDS       T02926                                 

Definition
(RefSeq) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gsl01100  Metabolic pathways
gsl01110  Biosynthesis of secondary metabolites
gsl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gsl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gasu_16620
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Gasu_16620
Enzymes [BR:gsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Gasu_16620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-GeneID: 17089839
NCBI-ProteinID: XP_005707689
UniProt: M2Y5P0
LinkDB All DBs
Position
Unknown
AA seq 624 aa AA seqDB search
MFFISSLFHWKRREESSCVTLAKDTRSYNTCFVVLRFTKKNCLSQTNTVRPTFRTSFKAF
LRETLKCQNTDKNSRQFLVETSFEQFSSLAKEANLVPVFTRLFSDHLTPVSAFRCFISEQ
ETQVPCFLLESVTGGENVGRFSFLGLQPRFLFLAKQHEIQYIEYSSSGTSKRTVVDERRY
SAEDPTLELRKIAQKISTASDEQLPLESALSGGWVGYFSYDTMRYTSPKKLPFSSAPKDD
RNLPDICMGQYREVIAFDNVNKLVYVVVWEDWKEHKSLRDAYENAVSNLQRLSETISNGI
LRSPLSSAVMDINTRLRGPKNSVSNMSKEYFLESIDKIHKHILDGNSFQTVFSQRFRRKT
EAHPFSIYRALRVVNPSPYMIYMQCPSCILVASSPEILCKVTNRMMINRPLAGTRHRGVT
EDEDAELEKELLGDEKDCAEHVMLVDLGRNDVGKVCKYGTVKVPKLMEIEKYSHVMHISS
TVTGILCDEYASWDALQSALPAGTVSGAPKVRSMQIIDSLEPTMRGPYGGGIGYITFQDN
MNMALALRTIVIPFQSSRGPDEEGLWTVDIQAGAGIVADSVPELEYQETENKAAALEVAV
DVAERLFSSHFKPKLSSNEIAFHA
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgttttttataagtagtttatttcactggaagagaagagaagagtcttcttgtgtcaca
ctggcaaaagacactcgttcatacaatacgtgctttgtagttttgaggtttactaagaaa
aattgtctttcacaaacaaatacagttcgaccaacgtttagaacttccttcaaagctttt
cttcgtgagacgttgaagtgtcagaataccgacaaaaattctcgccagtttttggtagaa
acaagctttgagcagttttcttcgttagcaaaagaagcaaatctggttccagtgttcact
aggttgttctcagatcatctaactccagttagtgcgtttcgttgctttataagcgaacaa
gaaacacaagttccttgttttttattggaatctgtcacaggtggtgagaacgtgggtcga
ttttcctttttaggactccagcccaggtttctctttttagcaaaacagcacgaaatacaa
tatatagaatattcctcttcaggaacctcaaaaagaaccgtagtagatgagagacgttat
agtgcagaggatccaactttggagttgaggaagattgcacaaaagatatcgacagcttcc
gatgagcaactgcctttggaaagtgctttgagtggtggttgggtcggttatttttcatat
gatacgatgaggtatacttctcccaaaaaacttcccttctcttctgctcctaaagatgat
cgaaatttgccagatatctgtatgggtcaatatcgagaagtgattgccttcgataacgtg
aacaaattagtatacgttgttgtgtgggaagattggaaggaacataagagtttaagagat
gcatatgagaacgcagtatctaatctacaacgtttatccgaaacaatatccaatggtatc
ttacgttctcccctctcaagtgcagtgatggacatcaacacaagattacgtggaccaaag
aattccgtttctaatatgagcaaagaatacttcttagaaagtatcgataagattcataag
catattttggatggaaactcatttcagactgtatttagtcagcgttttagaagaaagact
gaggcacatccattttctatctatcgagcacttcgtgtcgtgaatccttcgccttatatg
atttatatgcagtgtccaagttgcattctcgttgcatcatcaccggagatattatgcaaa
gtgacgaatagaatgatgatcaacagaccactcgctggaacacgtcatagaggagttaca
gaagacgaagatgcagaattggaaaaagaattacttggagatgaaaaggattgtgctgaa
catgtgatgttagttgacttgggtcgcaatgatgtaggaaaagtttgcaagtatggaact
gtaaaagttccaaagttgatggaaatagaaaaatatagtcatgttatgcatattagtagt
acagtaactggaattttatgtgatgaatatgcttcttgggatgctttgcaatctgcactt
cctgctggaacagttagtggtgctccaaaggtgcgttccatgcaaattattgattcgtta
gaaccaactatgagaggtccttatggtggtggaattggttatataacttttcaagataat
atgaatatggcattggctttgcgcacgatagtcataccttttcagagttcaagaggtcct
gacgaggaaggactgtggactgtggatattcaagctggtgctggcatagtagccgactca
gttcctgagcttgaatatcaagagactgaaaataaggctgcagctctagaagtagctgta
gatgtcgctgaaagattattttcgtcacatttcaaacctaaactttccagtaacgagata
gcatttcacgcatga

DBGET integrated database retrieval system