KEGG   Galdieria sulphuraria: Gasu_25520Help
Entry
Gasu_25520        CDS       T02926                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00500  Starch and sucrose metabolism
gsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gasu_25520
Enzymes [BR:gsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Gasu_25520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 17088924
NCBI-ProteinID: XP_005706697
UniProt: M2XJ88
LinkDB All DBs
Position
Unknown
AA seq 508 aa AA seqDB search
MKLIFYTLFLWVLVSYIVQAQPLPSPTEWQKELEEWIPKQYNRSVEGIFDNINRPGTAKG
CIVAADSKKQPDYYYNWIRDAAITMQVVVTMYERATDPKEIDRLETIIKEYIAFNHKLQH
TPNYNGNFYTGGLGAAHFLVNGSAYPGGWCTENDGPALRALAVIKFTYAYLQKGGNISYI
RDHVFGPTNNTLTRADLDYIARVWPNENCGPWEELYGIHFFDQYLQRTALLRGVKLAKKL
GYDDIAKHYQKSADDITQVLPSYIAKDFGIVLESVNTTHDTNHETFLDTSTILAIIHGYN
HDDVFAPTNEYVIGTANMLRLVFQDIYPVNMRKEQSEGTLFGRFPDDIYDGYTSDVPGNP
WILCTLGMAQYYYELAAEWLKHEKIVIGKWSKDFFKHLKVMPPGPPTPESTTTITGKAIC
SYVSALLEEGDRVLNAIRRHTIPSGMFTEEIDRYTGFEQGAINLTWSYDAFVTAVWSRED
VHKYFSHYCEPPSPVSPSPPMMGPGPSP
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgattttttatactctttttctatgggtacttgtaagctatatagttcaagct
caacctttgccttctcctacagagtggcaaaaggagctagaagagtggatcccaaaacag
tacaaccgttctgtggaaggtatttttgacaatatcaaccgaccaggtactgcaaagggt
tgtatcgtagcagcagactcgaagaagcaacccgattattattacaactggattcgagat
gcagcaatcaccatgcaagtagttgtcacaatgtatgagagagcaacggatcccaaggaa
atagacagattggaaactattatcaaagagtacattgcctttaatcataaactgcagcat
actccaaactacaatggcaacttttatacaggtggtttaggtgctgctcattttctggtc
aatggctctgcttatcctggaggatggtgtacagaaaatgatggtcctgcccttcgtgct
cttgcagttatcaagtttacttatgcgtatttacaaaaaggaggcaatatttcctatatt
cgtgaccacgtatttggtccaacgaataatactcttactcgagcagatttagattatatc
gcacgtgtatggcccaacgaaaactgtggaccctgggaagaactttatggaattcatttc
tttgatcaatacttacagaggactgcacttcttagaggtgtcaaattggctaagaaactt
ggatacgatgatattgcaaaacactatcaaaagtcagccgacgatataactcaagttttg
ccatcctatattgcaaaggactttggcattgttttggaatccgtaaatactactcacgat
accaatcatgaaacatttctggatacttccactattttggcaattattcatggttataat
catgatgatgtgtttgcacctactaatgaatatgtcattggaactgctaatatgttgcgt
ttggtgtttcaagatatttatccagtgaatatgcgcaaggaacaaagtgaaggaactctg
tttggaagatttccagacgatatttacgatggctatactagtgacgttccaggcaatcca
tggattctatgtactttaggaatggcacaatattattatgagttggctgcggaatggttg
aaacatgagaagattgtcataggaaaatggagtaaagactttttcaagcatttgaaagtt
atgccacctggacctcctactccagaatcgactacaactattactggaaaagctatttgt
agctatgtttctgctcttttggaagaaggcgaccgagtgttgaatgctattcgaagacat
acaattccaagtggtatgtttacagaggaaattgatagatatacaggttttgaacaagga
gctatcaacttaacctggagctacgatgcctttgttactgctgtttggtctcgtgaagat
gttcacaagtatttttctcactattgtgaacctccttctccagtaagcccatctcctcct
atgatgggacccggtccgtctccttag

DBGET integrated database retrieval system