KEGG   Galdieria sulphuraria: Gasu_25530Help
Entry
Gasu_25530        CDS       T02926                                 

Definition
(RefSeq) alpha-glucosidase isoform 1
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00500  Starch and sucrose metabolism
gsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gasu_25530
Enzymes [BR:gsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Gasu_25530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 DUF5106
Motif
Other DBs
NCBI-GeneID: 17088925
NCBI-ProteinID: XP_005706698
UniProt: M2Y2J8
LinkDB All DBs
Position
Unknown
AA seq 529 aa AA seqDB search
MSNLLLSSQTKLVACITVLWLLLFHSSNAKHWKDSLERWIPKEIERSFQGIFYNIDPPGG
IPGSVTAADSHYQPDYYYNWIRDAAITMDVVVTLYETATEPSQVKKLEDILKSYVHYNYI
IQRTPNPTGNLTTGGLGAAHYLLNGSAFTGSWCSVENDGPALRAVAVMRFANEYLRRHGD
LSYVKKWIFNNETHPPTTVTRADLDYIARVWPDPCCGPWETFFVVHFWDQLLIRKALLQG
AKFAKMLGYMDASSYYSKQAKELTSNMSKFISQVHGVVLESIDAPRDTIHETFIDTSTIL
AVLYGYNDDGFYAPDDPYVMNTANLLRLIYKDLFPVNRRRSQDEGVLFGRFPNGKKKIQS
NGIYLANILLDNYDGIATGDGVKGNPWFLCTLGMARYYFELAKRFSEYTTLTIHSRWMLP
LLAHLSSYSSNPTPTILGEAPPEKHFQVGETLQKAQLCQIAQALLTEADKIVYAVYRHVP
ETGMLTEEINRFTGFEQGAKNLTWSYDSFVTAIWSRNHSLQTFHSNCAF
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacttactcctttcaagtcaaaccaagctcgttgcttgtataactgtactttgg
ttactactcttccattcttctaatgccaaacattggaaagactcattagaaagatggata
ccaaaagaaatagagagatcattccaagggatattttacaatattgatccacctggaggt
attcctggttcagttacagcggcagattctcattaccaacctgattattattacaactgg
attagagatgctgctataacaatggatgtcgtagttactctctatgaaacagcaactgaa
ccttcacaagtaaaaaaattggaagatatccttaaaagttatgtgcattacaactatatc
attcaaaggactcctaatccaactggaaatttaacaactggtggtttaggtgctgcacat
tatcttctcaatggttccgctttcactggatcatggtgtagtgtagagaacgatggaccg
gcattacgtgctgttgcagttatgcgatttgccaatgaatacttacgtagacatggtgac
ttgtcctatgtcaagaaatggatcttcaataatgaaacgcatcctccaactacagttact
cgtgcagatttagactatattgccagagtatggcccgatccatgctgtggcccttgggaa
accttctttgttgttcatttttgggatcagttgttgattcgcaaagctctattacaagga
gcaaaattcgcaaaaatgcttggctatatggatgcttcgtcctattattcaaaacaagca
aaggagttgacaagtaatatgagcaaattcatttctcaagttcatggcgttgttcttgag
tctatagacgctcctcgagataccattcatgagacttttatcgatacttcgactatactt
gcagtactttatggatacaacgatgatggtttctatgctcctgatgatccatatgtgatg
aatacagccaatttgttaagactcatttacaaagatttgtttccggtcaatcgtcgtaga
tcacaagatgaaggtgtcctatttggaagatttccaaacggtaagaagaaaatccaaagc
aatggaatatacttggctaatattctgttagacaactatgatggtattgccactggagat
ggagtcaaaggcaatccttggttcctatgtacgttaggaatggcaagatactattttgag
ctagcaaaacgcttctcagaatatacaacattgacgattcactcccgatggatgctgcct
ctattggctcacctgagttcctactcttccaatcctacaccaacaatcctcggagaagca
ccaccagaaaaacacttccaagttggagaaactcttcaaaaagcacagctctgtcagatt
gctcaagctttgctcaccgaagccgataaaattgtttatgctgtttaccgtcacgttcct
gagacaggtatgctcaccgaagaaatcaaccgttttactggctttgaacaaggagccaaa
aacctcacttggagttatgactcttttgttactgcgatttggagcagaaatcattcctta
caaactttccatagcaattgtgccttttaa

DBGET integrated database retrieval system