KEGG   Galdieria sulphuraria: Gasu_26370Help
Entry
Gasu_26370        CDS       T02926                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00620  Pyruvate metabolism
gsl00710  Carbon fixation in photosynthetic organisms
gsl01100  Metabolic pathways
gsl01200  Carbon metabolism
Module
gsl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gasu_26370
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Gasu_26370
Enzymes [BR:gsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Gasu_26370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 17088810
NCBI-ProteinID: XP_005706572
UniProt: M2XIX2
LinkDB All DBs
Position
Unknown
AA seq 941 aa AA seqDB search
METPTSLDLTSSASYESFVSRKDGKYKESVDFALPLKSDIDYIRSSLLNIIGSRCGHETY
EAIEKIRELSYIYDTQQQDTNFVDLCRYIESLPENKMLMATSFFSNMCNIVNYADYVHRL
RRRRAFERGDSEMFQRYSCDEIFQELLNHGFTPEEIHSYICQIQCEMVLTAHPTQAVRRS
LLSKLSKLATCLLERDRTDLTPAERERLEQILECALSALWRTDEVRRTKPKPEDEARSAL
QVVEDTIWQAVPRYIRSIDRSLAKIGAPPLPLDTVPFLFGSWAGGDRDGNPFVTADVTRR
VCLLNRLRALNLYLQEVEDLLFDLSLHYASDELHEYNKRLPLTNSEYLEKERLKYKEFWN
HVPPAEPYRLLLAYIRDRLTATKVYTENILSDRPTAEPDPQAPIYTHIDELLEPLYVMYR
SLHDTGDGVIAEDHLKDFIRQAKCFGLELVRLDIRQEADRHTKAMAAITGYIGMGDYSQW
DEETRLSFLNEVLSSRRPLIPRRFPCDENVQEVLDTFQVCADLGASSLGAYIISMCMASS
DVLLVEVFQREFCMSRPTQRVVPLLETIHALQNATKMMETLFSNTWYRQHLEESFGNIQE
IMVGYSDSGKDGGRLTSAWELYKAQESLTRVAEKYGVTLRFFHGRGGTVGRGGGPQHLAI
LSQPPGTINKYFRVTIQGEVIQQDFDLPGLADRTLECYLTAILKAEMMPYSQVKSEWREL
MDAMSQISYKTYRSVVYEKPDFVKYFRYATPEQEIGRLNIGSRPQKRKDGGVETLRAIPW
IFAWNQTRLHLPVWLGTGAAIDYAKKTNKLETLQSMYKEWPFVHSYFDLMTMVLAKADSR
ISAKYDTELVPKELQSFGSSLRKLLAETIDMVLYVTGEKRLLDNDIVMQRAMDSRRQWLT
PMHIVQVEILKRLRAGTETQTIVDTLVISMKAIAAGMQNTG
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggagacgccgacatctttagatctcacaagcagtgcaagctacgaaagcttcgttagt
agaaaggatgggaaatacaaggaaagcgttgactttgctttacccttgaagagtgacata
gattacatcagaagttcccttttgaatatcataggttctcgttgtgggcacgaaacgtat
gaggctatagagaagattcgagagctttcttacatatatgatactcaacagcaagatacc
aactttgtagacttatgccggtatattgagtccttaccagaaaacaaaatgttgatggca
acttcttttttttcaaatatgtgtaacattgtcaactatgctgattacgttcaccgactt
cgaagaaggagagcgtttgaaaggggggactctgaaatgtttcaaagatattcttgcgat
gaaatctttcaagagttactaaatcacggttttacaccagaagaaattcacagctatatt
tgtcagatccaatgtgaaatggtactcactgcgcacccgacgcaagctgtaaggcgaagt
ttattatcaaagttatcaaagctagcaacttgtttgctcgaacgagatcgaaccgacttg
actccggcagaacgagaaaggttggagcaaattttggagtgtgccttatctgcattatgg
cgtactgatgaagtaagaagaacgaagccgaagcctgaagatgaagccagaagcgcttta
caagtagttgaagatactatttggcaagcagttccaagatatattcgctctattgatcgc
tctttagcgaaaattggagctcccccgttgcctttggacaccgttccatttttgtttggt
tcttgggccggaggtgatagagatggaaatccattcgttacagctgatgtaaccagaaga
gtctgtctgttgaatcgattaagagctctcaatctgtacctgcaagaagtagaagatctc
ctgtttgatttgtcgttgcattatgcgtcagatgagctgcatgaatacaacaaaaggcta
cccctaacaaactccgaatacttggaaaaggaaagactgaaatataaagaattttggaat
catgttcctccagcggaaccatatcgattgttattggcatatattcgagatcgtttgacg
gcaacaaaagtgtatacggaaaacatattaagtgacagaccgacagcagagcctgaccca
caagcacctatatacactcatatagatgaattactcgaacctctatacgtcatgtatcgt
tcattgcacgacacaggagacggcgtcatagcagaagaccatttgaaggactttattcga
caggccaaatgttttggtttggaattggttcgattggacattcgacaagaagcagataga
catacgaaagctatggcggcaataacaggatacatcggaatgggagactattctcaatgg
gatgaagagacgaggttgtcgtttttgaatgaagttctttccagtcgtcgacctctgatt
cctcgtcgttttccctgcgatgagaatgtgcaagaagtattggacacatttcaagtttgc
gctgacttgggtgcttccagtcttggtgcttatatcatttcgatgtgtatggcatcttct
gatgttttacttgtggaagtgttccaacgggagttctgcatgagtcgcccgacacaacgg
gttgttcctttactggagaccatccatgctttgcaaaatgcgacaaagatgatggaaact
ttgttctcgaatacttggtatcgacaacaccttgaggagtcctttgggaatattcaggaa
attatggttggatatagtgactctggaaaggatggcggtaggctaaccagcgcctgggaa
ctttacaaggctcaagaaagtctcaccagagttgccgaaaaatatggagtgactctgaga
ttctttcatggtcgtggtggaacggttggtcgtggtggaggaccacagcatcttgctata
ctttcgcaaccacctgggacaatcaataaatatttcagagtaacaattcaaggagaggtt
attcagcaagattttgatttacctggtttagctgatcggacgttagaatgttatttgact
gctattcttaaagctgaaatgatgccatattcacaagtcaagtcagaatggagagaactt
atggatgccatgagtcagatatcctacaaaacatatcgcagtgttgtatatgaaaagcca
gactttgtaaaatactttcgttatgccactccagaacaagaaattggacgtttgaatatc
ggttcacgtcctcaaaagcgtaaggatggtggagtggaaactttacgtgccattccatgg
atatttgcgtggaaccagaccagactccatttgcctgtttggttgggaactggtgcggcg
attgattatgcgaagaaaacgaataaattagaaactcttcagtcgatgtacaaggaatgg
ccttttgttcactcctattttgacttgatgactatggttcttgccaaagcagatagtcga
atatcagcaaagtatgatacggagctagttcctaaagagttacagtcgtttggaagttcg
ttgagaaaacttttagctgaaaccatcgatatggtattgtatgtgactggtgagaagcgt
ttgttagacaatgacattgttatgcaacgagcaatggatagtcgtcgtcagtggttgact
cctatgcatatcgtgcaagtagaaatcctcaagagacttcgtgctggtacggaaactcag
acaattgtggatactttggttatctcaatgaaagccattgcggcggggatgcaaaacact
ggttaa

DBGET integrated database retrieval system