KEGG   Galdieria sulphuraria: Gasu_47760Help
Entry
Gasu_47760        CDS       T02926                                 

Definition
(RefSeq) enoyl-[acyl-carrier protein] reductase I isoform 1
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00061  Fatty acid biosynthesis
gsl00780  Biotin metabolism
gsl01100  Metabolic pathways
gsl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gsl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Gasu_47760
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Gasu_47760
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Gasu_47760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gsl01004]
    Gasu_47760
Enzymes [BR:gsl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Gasu_47760
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Gasu_47760
Lipid biosynthesis proteins [BR:gsl01004]
 Fatty acid synthase
  Component type
   Gasu_47760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase Polysacc_synt_2 KR
Motif
Other DBs
NCBI-GeneID: 17086521
NCBI-ProteinID: XP_005704150
UniProt: M2WUK4
LinkDB All DBs
Position
Unknown
AA seq 308 aa AA seqDB search
MLSFTSLSHPRLLKRSTHSSYRVWLASKSVRKSSTRMTLESALETKPLVDLRNKKALVTG
IANNKSIAYGIAQALREAGAELGITYLPVNDRVQDKIKQLTEPLEPSLFIPCDVQKPNDL
DHLVSQIQSNWSQLDILVHCLAFANKEDLIGEFSKTSKSGFELALNVSAYSLIELCGKTK
HLMKPGSSVLTMTYLGGDKVVPNYNVMGVAKAALEASVRYLASEMGPDGIRVNAISAGPI
RTLASSAIGGIMDMIDHVEKNAPLRRTVTQREVGNTAAFLLSHASSGITGQVVYVDAGYQ
IMGAAMNH
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgttgagttttacaagtctctctcatcctcgtttactcaaaaggtcaactcattcaagt
tatcgtgtgtggttagcttccaaatctgtgcgcaagtcttctacacgaatgacgttggaa
tctgctcttgaaactaaacctttagtagatcttcgcaataaaaaagcgttggtgacaggt
atagcaaataacaagtcgattgcttatggaattgcccaagcacttcgcgaagcaggtgcc
gagctgggtattacttatctacctgtgaacgatcgagtacaagataaaatcaaacagcta
acagaacctttggaacccagtctatttattccttgtgatgttcagaaacctaacgatttg
gatcatctcgtttctcagatacagagcaactggagtcagttggatattttagttcattgt
ttggcctttgcaaacaaagaagacttgattggagagtttagtaagacttcaaagtcagga
tttgagttggctttgaatgtgagtgcctattctttgattgagttgtgtgggaaaaccaaa
caccttatgaaacctggttccagtgttcttacgatgacctatcttggaggagacaaggtc
gttcctaattacaatgtgatgggagtagccaaagcagctttggaagcttcggttcgatat
ttggcatcagaaatgggaccggatggaattcgagtcaatgcaattagtgcaggaccgata
agaactctggcatcttcagctattggaggaatcatggatatgatcgatcatgtagaaaag
aatgctcctttaaggagaacggttactcaaagagaagtaggaaatacggcagcttttctt
ctttctcatgcttcatctggaataacgggacaagtagtttatgtggatgctggttatcaa
attatgggagctgccatgaatcactaa

DBGET integrated database retrieval system