KEGG   Gynuella sunshinyii: YC6258_00881
Entry
YC6258_00881      CDS       T03690                                 

Definition
(GenBank) putative Rossmann fold nucleotide-binding protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
gsn  Gynuella sunshinyii
Pathway
gsn00230  Purine metabolism
gsn00240  Pyrimidine metabolism
gsn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YC6258_00881
   00240 Pyrimidine metabolism
    YC6258_00881
Enzymes [BR:gsn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     YC6258_00881
    3.2.2.-  
     YC6258_00881
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: AJQ92931
UniProt: A0A0C5VFH6
LinkDB
Position
complement(862638..864014)
AA seq 458 aa
MSQTTRAVKSASLSPRGSLEILSQQEVAKVRTTGQNGMHELFRRCALAILNTGSDVDNAK
TLLEAYPNFDIELEQQDRGIKLIVKNAPAEAFVDDDMIASTREMLFSALRDIVYSQSGID
THVENLKSGKDITEYVFRFLRNARAFAPGREPNLVVCWGGHSINNREYKYTKNVGHELGL
RGMNICTGCGPGAMKGPMKGAIIAHAKQRVQGGRYLGVTEPGIIAAEAPNPIVNELVIMP
DIEKRLEAFVRVGHGIVIFPGGAGTAEELLYILGILLHPENVSIPFPLILTGPKESENYF
QELHEFINTTLGFEAQQKYKIIIDNPAQVAREMAQGLHDVREFRIKMADAFHFNWLLTID
KAFQQPFEPSHENMAKLELSHKLPVHTLAANLRRAFSGIVAGNVKEQGIRTIEEKGPFEI
NGDPRIMEPLDRLLQAFVEQHRMKLPGSKYEPCYRLKK
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgagtcaaacgaccagagcagtcaaaagcgcttccctttctcccagaggaagtctcgaa
atattgtcccagcaggaagtggccaaggtcagaaccactggccagaacggcatgcatgag
ctgtttcggcgatgcgcgctggcgatcctgaacaccgggtctgatgtcgacaacgccaaa
accctgctggaagcttatcccaactttgacatcgaacttgaacagcaggatcgcggcatc
aaactgatcgttaaaaatgcaccggctgaagccttcgtcgacgatgacatgattgcctca
acccgggaaatgctgtttagtgccctgcgcgacatcgtctacagtcaaagcggtatcgac
actcacgtcgaaaatctcaaaagtggtaaagacattactgaatacgtgtttcgcttcctg
cgtaatgcccgtgcctttgcacctggccgcgaacccaatctggtagtttgctggggtggt
cactcaatcaacaaccgggaatacaaatacaccaaaaacgtcggtcatgaactcggcctg
cggggcatgaacatctgtaccggctgtggtcccggtgccatgaaagggccgatgaaaggc
gccattattgcccatgccaagcagcgcgttcagggtggccgctatctcggtgttaccgaa
ccgggcatcatcgccgccgaagcgcctaatccgatcgtcaatgaactggtcatcatgccg
gatatcgaaaaacgcctggaggcctttgtccgggtcggtcatggtattgttatttttccg
ggaggtgccggcaccgccgaagaattgctgtacatcctgggtattctgctgcacccggaa
aacgtctcaattccattcccgctgattctgaccggtccgaaagaatcagaaaattatttc
caggaactgcacgagtttatcaataccacgctagggttcgaggctcagcagaaatataag
atcatcatcgacaaccctgcccaggtggcacgcgaaatggcccagggtctgcacgatgtg
cgggaattccgaatcaaaatggcggatgcctttcactttaactggctgctgaccatcgac
aaagcttttcaacaacccttcgaacccagccatgagaatatggccaaactcgaactgagc
cataaattaccggtccatacactggctgcaaacctgagacgggcattttccggcattgtc
gccggcaatgtgaaagaacagggaattcgcaccatcgaggaaaaaggaccatttgagatc
aatggcgatccccgcatcatggagcctcttgaccggctgctgcaggcctttgtggaacag
caccggatgaaactgcccggctccaaatatgaaccgtgttaccggttgaagaaataa

DBGET integrated database retrieval system