KEGG   Gynuella sunshinyii: YC6258_01700Help
Entry
YC6258_01700      CDS       T03690                                 

Definition
(GenBank) alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gsn  Gynuella sunshinyii
Brite
KEGG Orthology (KO) [BR:gsn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YC6258_01700
Enzymes [BR:gsn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     YC6258_01700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA FAD_oxidored FAD_binding_2 Thi4 AlaDh_PNT_C NAD_binding_8 DAO NAD_binding_7 Glutaredoxin Thioredoxin_4 Lycopene_cycl FAD_binding_3 K_oxygenase Thioredoxin_9 DSBA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AJQ93748
UniProt: A0A0C5VK71
LinkDB All DBs
Position
complement(1652435..1654033)
Genome map
AA seq 532 aa AA seqDB search
MFEHRIHQDNQAVTMLTNDIKTALKSYTANMTRTVTLVLQTGEHAKRDELVSFLTDFASI
SDKVRFEQRDLAGQVRSPLSFVLEVDNEPNGIVFSGIPGGHEFNSLVLAVLQSAGTPLKL
DESIQKIITGVQEDLHFEVFVSLSCHNCPDVVQALNQFALLNPHIRTEMIEGGVFQDVIE
SRNIQGVPTVYLNGEVFANGKIDTAKLLEKLIEKYPGITQGSQTGEQLPVQDVTVIGGGP
AGVAAAIYAARKGLKVTMVADRIGGQVKDTLGIENLISVPKTTGPELAGALQQHMDDYTI
TKREHLRVDRIEKGALKTVHLSSGESFETKTLIIATGAKWRELGVPGEQENIGNGVAYCP
HCDGPFFKGKDVAVIGGGNSGIEAALDLAGIVKSVTVFEFLPELKADQVLVKQAEARDNI
TILKNVATRQIIADNGKVTAIEYQDRETEQVRTQDLAGVFVQIGLVPNSAFLKDVVEMTR
FGEVVINEKGETSEPGIFACGDVTTVPYKQIVIAMGEGAKASLAAFEYLLKH
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaacatcgtattcatcaggacaatcaggcagtcaccatgttaacgaatgatatt
aaaaccgcactgaaaagttataccgccaacatgacccgtaccgtgacactggtgctgcaa
accggtgaacacgccaaacgcgatgagttggtgtcgtttttaaccgactttgcctcaatc
tccgacaaggtccggtttgaacagcgcgatctcgccggtcaggtacgcagcccgctgagc
tttgtgctggaagtggacaatgaacccaatggcattgtgttttccggtattcccggcggt
catgaatttaattctctggtgctggcggtattacagtctgccggcacccctttgaagctc
gatgagtcaattcagaagatcattaccggcgttcaggaggatctgcactttgaggtgttt
gtgagcctgagttgccataactgcccggacgtggtccaggcgctgaatcagtttgccttg
ctgaatccgcatatccgcacggagatgattgagggcggggtgtttcaggatgtgatcgag
agccgcaatatccaaggggttccaacggtgtatctgaatggcgaggtgttcgccaatggc
aagatcgataccgctaagctgttggagaagctgattgagaagtatcccggtatcactcag
ggcagtcagacaggcgaacaactgccggtacaggatgtcacggtgattggtggcggtccg
gccggggtggctgccgccatctacgcagcccgtaaggggttgaaggtgaccatggtggcg
gatcgcatcggcggtcaggtcaaggatacgctgggtatcgagaatctgatttcggtgcct
aaaaccaccggaccggaactggccggggcgttacagcagcatatggatgattacaccatc
accaagcgtgagcatttacgggtggatcgcattgaaaagggtgcattgaaaaccgtacac
ctgtcttcaggggagtcgtttgagaccaaaaccctgatcattgccaccggtgccaaatgg
cgtgaacttggagtaccgggtgagcaggaaaacatcggtaatggtgtagcctactgcccg
cactgcgatggtccgttctttaagggtaaagatgtggcggtgatcggaggcggcaactcc
ggcatcgaggcggcactggatctggccggtatcgtgaaatcggtgacggtgtttgaattc
ctgccggaactcaaggccgatcaggtgttggtgaaacaggcggaagcccgcgacaacatc
acgattctgaagaatgtggcgacccgccagatcattgccgataacggtaaggtcacggcc
atcgagtatcaggaccgcgaaaccgaacaggtgcggacacaggatttagccggggtgttc
gtccagatcggtctggtaccgaacagcgcgtttttgaaagacgtggtggagatgacccgt
tttggtgaggtggtgatcaatgaaaaaggtgagaccagtgaacccggcatttttgcctgt
ggtgatgtcaccactgtgccgtacaagcagatcgtgattgcgatgggcgaaggggcaaaa
gcatcactggccgcgtttgagtatttgttgaagcattaa

DBGET integrated database retrieval system