KEGG   Gynuella sunshinyii: YC6258_03849
Entry
YC6258_03849      CDS       T03690                                 

Definition
(GenBank) putative N6-adenine-specific DNA methylase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
gsn  Gynuella sunshinyii
Brite
KEGG Orthology (KO) [BR:gsn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gsn03009]
    YC6258_03849
Enzymes [BR:gsn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     YC6258_03849
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     YC6258_03849
Ribosome biogenesis [BR:gsn03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    YC6258_03849
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 Methyltransf_31 MTS THUMP Methyltransf_25 Methyltransf_15 PrmA Methyltransf_11 Methyltransf_12 Spermine_synth CATSPERB
Other DBs
NCBI-ProteinID: AJQ95885
UniProt: A0A0C5V942
LinkDB
Position
complement(4169145..4171304)
AA seq 719 aa
MNSLLIVSCPKGVEQLLLEELIQLGLEHPKETVGAISGYASAEVYYRILLWSRLASRVAL
VLASGPVTTFETLAFHINTVDWTEHLRASGSFKVQFKGELKDIRNEVFGAQKTKDVVVDQ
FRLKTGVRPSVQKDQPDIVIDIRIKKGQATIALDLSGEPLHRRGYRLAGSKAPLKENLAA
AVLLRAGWPMIAARQGALVDPMCGSGTFLIEAAWMAGDRAPGLTRRYFGFKGWLQHDHEL
WNRLLEEARQRRAAGEAGIPPLLGYDADAGVIRNANENIHRAGLKGVAFAYHKELAEWVK
PTHIDLNPGLLICNPPYGERLGEINSLKGLYRYLGRLLVSQLLGWQAAVLTGNPDLGHAM
GLRAGKQYRIFNGSIDCKILTFDIDEQAVRKSEKKSEAGQVELSEGAQMFANRLAKNLKK
AKKWPQTLNTDAYRLYDADLPEYSVAVDLYGNYLHVSEYKAPAKIPEEKTQARLADIMTA
LPQVMQVPEDHIYLKERKRQKGKQQYEKFAAVSKEVIVSENGLEVIVNLSDFLDTGLFLD
HRPIRHYIQTHSKGKSFLNLFCYTGVASLHAAKGKASKTTSVDLSKTYLKWAQRNFELNG
FSDRHHQFVEADCKQWLQQAAKEGSKYDLIFMDPPSFSNSKKMIEVLDIQQDHSELIHGA
MKLLSQDGVLIFSNNQRKFVLDETLTMRFAVEDITAQTIPLDFARTPNIHRCWMIRHPR
NT seq 2160 nt   +upstreamnt  +downstreamnt
ttgaattcactattgatcgttagttgccctaaaggcgtagaacagttgttgctggaggag
ttaatccagctgggtcttgagcatccgaaagaaacggttggtgctatatcaggatatgcc
agtgccgaagtgtattataggattctgctttggagtcgcctggccagtcgtgtagcacta
gtgttggcgagtggaccggtgactacgtttgaaacactcgcatttcatattaatactgtg
gattggacagagcatttgcgtgccagcggtagctttaaagtccagttcaagggcgaacta
aaagacattcgcaatgaggtttttggagcacagaaaaccaaagatgtcgtggttgaccag
tttcgtcttaaaacgggcgttcggccaagtgtgcaaaaagaccaacccgatatcgtcatc
gatattcgaatcaaaaaaggtcaggcaacgattgcccttgatttatccggtgaacctttg
catcggcggggttatcgtctggcaggtagtaaggcaccattgaaggaaaacctggcagcc
gctgtgttgttaagagccgggtggccgatgatagcggccaggcagggggcactcgttgat
cctatgtgtggatcgggtacttttctgattgaggctgcctggatggctggtgatcgggca
cctggcttgacccgccgttacttcggttttaaggggtggctgcaacatgatcatgagtta
tggaaccggctgttggaagaagcccgtcaacgcagagctgcgggtgaggccggtattcct
ccgttgcttggctatgatgccgatgcgggggtgattcgcaatgcaaatgaaaatattcat
cgagccgggctcaaaggggtggcctttgcttaccataaagagttggcagaatgggtgaag
ccgactcatatcgacttaaatcctgggctgttaatttgtaacccgccctatggcgagcgt
cttggagaaataaattcccttaaagggttataccgttatcttggtcgcttgctggtcagt
cagctgctaggttggcaggcagcggttctgaccggaaatcccgaccttgggcatgctatg
ggtctgcgggcaggaaaacagtaccgcatatttaacggctccattgattgtaagatcctg
acatttgatatagatgagcaggctgtcaggaagtctgagaaaaagtctgaagctggtcag
gttgagttgagcgaaggcgcgcaaatgtttgccaaccgtctggcaaaaaatctaaaaaaa
gccaaaaaatggcctcaaaccctcaataccgatgcctatcggctttatgatgcggatttg
cctgaatactcagttgcggttgacctttatggtaactatctgcatgtatcggaatataaa
gcaccggcgaaaatccctgaggaaaaaacacaggccagattggcggatatcatgacagct
ttgcctcaggtgatgcaggttccagaagatcatatttatctcaaagagcggaagcgccag
aaaggtaagcaacaatatgagaagtttgccgctgtgagcaaagaggtgatcgtctctgag
aatggtctggaagtgattgtgaatctttcagactttctcgataccggtttgtttttggat
catcgtcccattcgccattacattcagacccatagtaagggcaagtcatttcttaatctg
ttttgttataccggtgttgccagtttgcatgctgcaaaaggaaaagcctccaaaaccacc
agtgttgatttatccaagacgtatctgaagtgggctcaacggaacttcgaactgaacggt
ttcagcgatcgtcaccaccagtttgttgaagcagattgcaaacagtggttgcagcaggcg
gccaaagaaggttctaaatatgatctgatttttatggatccaccgtcattcagcaattca
aagaaaatgatcgaagtattggatatccagcaggatcatagtgagctgatccatggggca
atgaagctgctttctcaggatggggtgctgattttctccaataatcaaagaaagtttgtg
ctcgatgaaacattgaccatgcgttttgccgttgaggatattaccgcccagacaattccg
ttggacttcgcccgtacgcccaatattcaccgttgctggatgatcagacaccctcgatag

DBGET integrated database retrieval system