KEGG   Gynuella sunshinyii: YC6258_04337Help
Entry
YC6258_04337      CDS       T03690                                 

Definition
(GenBank) D-alanine-D-alanine ligase and related ATP-grasp enzyme
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gsn  Gynuella sunshinyii
Pathway
gsn00473  D-Alanine metabolism
gsn00550  Peptidoglycan biosynthesis
gsn01100  Metabolic pathways
gsn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gsn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    YC6258_04337
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YC6258_04337
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    YC6258_04337
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gsn01011]
    YC6258_04337
Enzymes [BR:gsn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     YC6258_04337
Peptidoglycan biosynthesis and degradation proteins [BR:gsn01011]
 Precursor biosynthesis
  Amino acid ligase
   YC6258_04337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AJQ96369
UniProt: A0A0C5W106
LinkDB All DBs
Position
4664834..4665931
Genome map
AA seq 365 aa AA seqDB search
MSSHKIKVAVVFGGRSAEHEVSLQSAQNVINSLDPEKFEPVLIGIDREGRWFLNEQSIQL
LNADNPSDIALNLSAPQVGLIPNGPERRLVRIDSQESLGQVDVIFPVLHGPYGEDGSIQG
LAKMANLPCVGADVTASALGMDKDIMKRLLRDAGILNAEFITLYHWQSEWPLEQIETEFG
YPVFIKPANMGSSVGVSRAKNREQLNQAIRHAFKYDQKVLVEKAVKGRELEISLLGNDEI
MASCVGEIIAADQFYSYESKYIDADAAELKIPAEISAQQTARIQQTAIEVYRLLGCSGLA
RVDMFLTPEDEIFINEINTLPGFTNISMYPKLWEHSGIPQQQLVTRLIELALERFDQKRH
LSTNR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtcataaaatcaaagtggcagttgttttcggtggacgctcagccgagcacgag
gtttcacttcagtcagcccaaaatgtcatcaactctctcgatccggaaaaatttgaaccg
gtcctgatcggtattgatcgcgaaggccggtggttccttaatgaacagtctatccaactg
ctgaatgccgataatccctctgatatcgctctcaatctgtcagccccgcaggtagggctg
attcccaatggcccggaaagacggctggttcgcatcgacagccaggagtccctcggtcag
gtggatgttatctttcctgtactgcacggcccgtatggagaggacggttctattcagggg
ttggccaaaatggcaaatctgccctgtgtaggcgctgatgtcacagccagtgcactgggt
atggataaagatattatgaagcgcttgttgcgcgatgccggtattctgaatgctgagttt
attaccctgtatcactggcaatcggagtggccactggagcagatagaaacagaatttggt
taccccgttttcatcaagcccgcgaatatgggctcgtccgttggtgtcagccgggctaaa
aaccgggaacaactgaatcaggccattcgtcacgcattcaaatacgaccagaaagtgttg
gtggaaaaagcggtcaagggtcgcgaactggaaatatccctgcttggaaacgatgagatc
atggcttcctgcgtgggtgaaattatcgccgctgatcagttctacagctatgagagcaaa
tatattgatgcagatgccgctgaactgaaaatacctgccgagatcagcgctcagcagaca
gccagaatccagcagacagcaattgaagtctatcgcctgctcggttgctccgggcttgcc
cgggtggatatgtttctgaccccggaggatgaaattttcatcaacgaaatcaatacgctg
ccgggattcaccaatatcagcatgtacccgaaactgtgggaacattcaggtataccgcag
cagcagctggtcacccgactcattgaactggccctggaacggttcgatcagaaacggcat
ctcagcaccaaccggtaa

DBGET integrated database retrieval system