KEGG   Geobacillus subterraneus: GS3922_02540Help
Entry
GS3922_02540      CDS       T04323                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gsr  Geobacillus subterraneus
Pathway
gsr01100  Metabolic pathways
gsr01110  Biosynthesis of secondary metabolites
gsr01120  Microbial metabolism in diverse environments
gsr01130  Biosynthesis of antibiotics
gsr01200  Carbon metabolism
gsr01210  2-Oxocarboxylic acid metabolism
gsr01230  Biosynthesis of amino acids
Module
gsr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gsr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GS3922_02540
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GS3922_02540
Enzymes [BR:gsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GS3922_02540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AMX82641
UniProt: A0A146CSC0
LinkDB All DBs
Position
530864..532135
Genome map
AA seq 423 aa AA seqDB search
MTQGEKITVTNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWKE
VLAGEKAYKLTGSWLPDETLETIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFQGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIR
FPETSGIGIKPISEEGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EQEFGDKVFTWAQYDRIVEAEGKEAANKALADAEANGKIIIKDAIADIFLQQILTRPREF
DVIATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIIQAMEKTIASKVVTYDFARLMEGATEVKCSEFADALIR
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggggaaaaaattactgtcaccaatggtgtgctcaacgttccaaacaatccg
atcattccgttcattgaaggggacggaaccggcccggacatttgggcagccgcttcgcgc
gtgctcgaagcagcggtggaaaaagcgtacaaaggcgagaagaaaatcgtctggaaggaa
gtgctcgccggtgaaaaggcgtataaactgacgggcagttggcttccggatgaaacgttg
gagacgattcgtgaatacataatcgccattaaagggccgttgacgacgccggtcggcggc
ggcatccgctcgctgaacgtggcgctccgccaagagctcgacttgttcgtctgcctccgc
ccggtccgctacttccaaggcgttccgtcgccggtcaaacggccggaagatacggatatg
gtcattttccgcgaaaacacggaagacatttacgccggcatcgagtatgcgaaaggcacg
ccggaagtgaaaaaagtgatcgactttttgcaaaacgaaatgggtgtgcgcaaaatccgc
ttcccggaaacgtccggcatcggcatcaagccgatttctgaagagggaacgaagcggctc
gtgcgtgcggcgatcaactatgcgatcgaacacggccgcaaatcggtcacgctcgtccat
aaagggaacattatgaagttcaccgaaggggcgtttaaaaactggggctacgagctggct
gaacaagagttcggcgataaagtgttcacatgggcgcaatacgaccgcatcgttgaagcg
gaaggaaaagaagcggcgaacaaagcgctggcggacgcggaagcgaatggcaaaatcatc
attaaagacgccatcgccgacatcttcctgcagcaaattttgacgcgcccgcgcgagttt
gacgtcatcgcgacgatgaacttaaacggcgactacatttccgacgcgctcgcggcccaa
gtcggcggcatcggcatcgcgccgggggcgaacatcaactatgaaaccggacatgccatt
ttcgaagcgacgcacggaacggcgccgaaatacgctggcttggacaaagtcaatccgtcg
tccgtcattttgtccggcgtcatgatgtttgagcatctcggctggaatgaagcagctaaa
ttgattattcaagccatggaaaaaacgattgcgtccaaagttgtaacgtacgatttcgcc
cgcctgatggaaggggcaaccgaagtgaaatgttcggaatttgctgatgcgctcatccgc
aatatggactaa

DBGET integrated database retrieval system