KEGG   Geobacillus subterraneus: GS3922_02540Help
Entry
GS3922_02540      CDS       T04323                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gsr  Geobacillus subterraneus
Pathway
gsr00020  Citrate cycle (TCA cycle)
gsr00480  Glutathione metabolism
gsr01100  Metabolic pathways
gsr01110  Biosynthesis of secondary metabolites
gsr01120  Microbial metabolism in diverse environments
gsr01130  Biosynthesis of antibiotics
gsr01200  Carbon metabolism
gsr01210  2-Oxocarboxylic acid metabolism
gsr01230  Biosynthesis of amino acids
Module
gsr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gsr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GS3922_02540
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GS3922_02540
Enzymes [BR:gsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GS3922_02540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AMX82641
UniProt: A0A146CSC0
LinkDB All DBs
Position
530864..532135
Genome map
AA seq 423 aa AA seqDB search
MTQGEKITVTNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWKE
VLAGEKAYKLTGSWLPDETLETIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFQGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIR
FPETSGIGIKPISEEGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EQEFGDKVFTWAQYDRIVEAEGKEAANKALADAEANGKIIIKDAIADIFLQQILTRPREF
DVIATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIIQAMEKTIASKVVTYDFARLMEGATEVKCSEFADALIR
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggggaaaaaattactgtcaccaatggtgtgctcaacgttccaaacaatccg
atcattccgttcattgaaggggacggaaccggcccggacatttgggcagccgcttcgcgc
gtgctcgaagcagcggtggaaaaagcgtacaaaggcgagaagaaaatcgtctggaaggaa
gtgctcgccggtgaaaaggcgtataaactgacgggcagttggcttccggatgaaacgttg
gagacgattcgtgaatacataatcgccattaaagggccgttgacgacgccggtcggcggc
ggcatccgctcgctgaacgtggcgctccgccaagagctcgacttgttcgtctgcctccgc
ccggtccgctacttccaaggcgttccgtcgccggtcaaacggccggaagatacggatatg
gtcattttccgcgaaaacacggaagacatttacgccggcatcgagtatgcgaaaggcacg
ccggaagtgaaaaaagtgatcgactttttgcaaaacgaaatgggtgtgcgcaaaatccgc
ttcccggaaacgtccggcatcggcatcaagccgatttctgaagagggaacgaagcggctc
gtgcgtgcggcgatcaactatgcgatcgaacacggccgcaaatcggtcacgctcgtccat
aaagggaacattatgaagttcaccgaaggggcgtttaaaaactggggctacgagctggct
gaacaagagttcggcgataaagtgttcacatgggcgcaatacgaccgcatcgttgaagcg
gaaggaaaagaagcggcgaacaaagcgctggcggacgcggaagcgaatggcaaaatcatc
attaaagacgccatcgccgacatcttcctgcagcaaattttgacgcgcccgcgcgagttt
gacgtcatcgcgacgatgaacttaaacggcgactacatttccgacgcgctcgcggcccaa
gtcggcggcatcggcatcgcgccgggggcgaacatcaactatgaaaccggacatgccatt
ttcgaagcgacgcacggaacggcgccgaaatacgctggcttggacaaagtcaatccgtcg
tccgtcattttgtccggcgtcatgatgtttgagcatctcggctggaatgaagcagctaaa
ttgattattcaagccatggaaaaaacgattgcgtccaaagttgtaacgtacgatttcgcc
cgcctgatggaaggggcaaccgaagtgaaatgttcggaatttgctgatgcgctcatccgc
aatatggactaa

DBGET integrated database retrieval system