KEGG   Geobacillus subterraneus: GS3922_03315Help
Entry
GS3922_03315      CDS       T04323                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gsr  Geobacillus subterraneus
Brite
KEGG Orthology (KO) [BR:gsr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GS3922_03315
Enzymes [BR:gsr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GS3922_03315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored AlaDh_PNT_C HI0933_like DAO FAD_binding_2 NAD_binding_7 Thioredoxin_4 FAD_binding_3 Glutaredoxin NAD_binding_8 Thi4 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AMX82784
UniProt: A0A146CUZ4
LinkDB All DBs
Position
695322..696845
Genome map
AA seq 507 aa AA seqDB search
MLDADIKAQLAQYLQLLENDIVLTVSAGDDNVSRDMLALVDELTAMSPKIKVEKAKLERT
PSFSINRVGENTGVTFAGVPLGHEFTSLVLALLQVSGRPPKVSEDVVRRIQQIRGKHHFE
TYVSLTCHNCPDVVQALNIMSVLNPDISHTMIDGAAFKDEVEQKGIMAVPTVFLNGEMFA
SGRMSIEDILAKLGSGPDAASFADKDPFDVLVIGGGPAGATAAIYAARKGIHTGIVADRF
GGQILDTLGIENFISVKYTEGPKLAASIEEHVKQYDVDIMIQRAKRLEKKDLIEVELENG
AVLKSKTVILSTGARWRNLGVPGEEEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGVEA
AIDLAGIAKHVTVLEFAPELKADAVLQDRLYSLPNVTVIKNAQTKEITGTDKVNGITYID
RETGEEHHIELQGVFVQIGLVPNTEWLEGTVERNRIGEIIVDKRGATNVEGVFAAGDCTD
SAYKQIIISMGSGATAALSAFDYLIRH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgcggacatcaaggcacaactcgcccagtatttgcaattgcttgaaaatgac
attgttttgacggtaagcgcgggagacgacaacgtttcccgcgatatgcttgctttagtc
gatgagttgacggccatgtcgccgaaaatcaaagtggaaaaagcaaaacttgaacgcacg
ccgagcttcagcatcaaccgggtcggcgaaaacaccggcgtcacctttgccggcgtcccg
ctaggccatgagtttacgtctttggtgctggccctgcttcaagtgagcggccggccgcca
aaagtgagcgaggatgtggtgcgccgcattcaacaaatccggggcaaacatcattttgaa
acgtacgtgagcttaacgtgccataactgcccggatgtcgttcaagcgcttaacatcatg
agcgtgctgaaccccgatatttcgcatacgatgatcgacggggcggcgtttaaggacgaa
gtggaacaaaaaggcattatggccgtgccgaccgtctttttaaacggtgagatgtttgcc
agcggccgcatgtcgattgaagacattctcgccaaactaggaagcgggccggatgctgct
tcgtttgccgataaagacccgtttgatgtgcttgtcatcggcggcggcccggcgggagcg
acagctgccatttatgcggcgcgcaaaggcattcacaccggcattgtcgccgaccgcttc
ggcggacaaattttagatacgctcggcattgaaaacttcatcagcgtcaaatatacggaa
ggaccgaagctggcggccagcatagaggagcatgtcaaacaatacgatgtcgacatcatg
atccagcgcgccaaacggcttgagaaaaaagacttgattgaagtggagctggaaaacggc
gccgtcttaaaaagcaaaacggtcatcctttctaccggcgcccgctggcgaaatctcggc
gtgccgggcgaggaagagttcaaaaacaaaggcgtcgcctactgcccgcattgtgacggt
ccgctgtttgaaggcaagcacgtggcggtcattggcggcggcaactccggcgtggaagcg
gcgattgaccttgctggcatcgccaagcatgtgaccgtgctcgagtttgcccctgaatta
aaagcggatgctgttttgcaggaccggctgtacagcttgccgaacgtgacggtcatcaaa
aacgcgcaaacgaaagaaattaccggtacagacaaagtaaatggcattacgtatatagat
cgggagacaggggaagagcaccatatcgagctgcaaggcgtattcgtgcaaatcggcctt
gtgccgaatacagagtggcttgaaggaacggtggaacggaaccgcatcggcgagatcatc
gtcgataaacgcggagcgaccaatgtcgaaggcgtctttgccgcgggcgactgtacggac
agcgcctataagcaaatcattatttcgatgggttcgggcgctaccgctgcattgagcgcg
tttgattacttaattcgccattaa

DBGET integrated database retrieval system