KEGG   Geobacillus subterraneus: GS3922_05255Help
Entry
GS3922_05255      CDS       T04323                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gsr  Geobacillus subterraneus
Pathway
gsr00564  Glycerophospholipid metabolism
gsr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GS3922_05255
Enzymes [BR:gsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GS3922_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored GMC_oxred_N Pyr_redox_2 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: AMX83143
UniProt: A0A143MKD3
LinkDB All DBs
Position
1055692..1057368
Genome map
AA seq 558 aa AA seqDB search
MMFSSRRRSELLNAMGEKTYDVLVIGGGITGGGIALDAVSRGMQTALVEMQDFAAGTSSR
STKLVHGGLRYLKQFEVKMVAEVGRERAVVYENGPHVTTPEWMLLPIYRGGTFGKWSTSV
GLWLYDRLAGVKRSERRTMLNASQTLEKEPLLKRDGLLGGGYYVEYRTDDARLTIEVIKK
AVELGADAVNYTKAEQFLYDDRGRITGVRCRDMLSGRTYDIRAKTVVNAAGPWVDTLRDK
DGSKTNKRLQLTKGVHLVIDQKRFPLKQAIYFDTPDGRMVFAIPRDGKTYVGTTDTFYDG
DPAHPTMTEEDRDYLLKAIEYMFPSVGITAADVESSWAGVRPLIYEEGKDPSEISRKDEI
WTSPSGLITIAGGKLTGYRKMAETVVDLIAEQLAKEEGKTFRSCQTKQLPISGGDVGGSH
RLPAFIAKKAEEAVRYGLTKEEGARLAKQYGTNVDRLFVLNRQYDRSAGLTRETFIRLVY
AIEEEMAVKPTDYFIRRTGALLFDIDSVRREKEAVIAFMARYLRWTGEQTATYAKELEQA
LRQAVLAEEGDDRRIVNK
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgatgttttcaagcagacggcggagtgagttgttgaacgccatgggtgaaaaaacgtac
gatgtgcttgtcatcggcgggggaatcactggcggcggcatcgctcttgatgccgtttcg
cgcggcatgcaaacagcgcttgtcgaaatgcaagatttcgccgccgggacgtcgagccgc
tcgacgaagctcgttcacggaggcttgcgctatttaaaacaattcgaagtgaaaatggtc
gccgaagtcgggcgcgaacgggcggtcgtttacgaaaacggcccgcacgttacgacgccg
gaatggatgttgctgccgatttaccgcggcgggacgttcggcaaatggagcacatcggtc
ggcctttggttgtacgaccggctggccggcgtgaagcggagcgagcggcggacgatgctt
aacgctagtcagacgttggaaaaagaaccgctcttaaagcgcgatgggctccttggcggc
ggctattacgtcgaataccggaccgatgacgcccgcctgacgattgaagtgatcaaaaaa
gcagtcgagcttggcgccgacgctgtcaactatacgaaagcagaacagtttttatacgat
gaccgcggccgcatcactggcgtccgttgccgcgacatgctgagcgggcggacgtatgac
atccgcgccaaaaccgtcgtcaacgccgccgggccctgggtcgatacattgcgcgacaaa
gacggctcgaaaacaaataagcggctccagctcacaaaaggcgtccaccttgtcatcgac
caaaaacggtttccgctcaaacaggcgatttattttgacacaccggacggccgcatggtg
tttgccattccgcgcgatggaaaaacgtatgtcggcacgaccgatacgttttacgacggt
gaccccgcccatccgacgatgacggaagaagaccgcgattatttattgaaagccatcgag
tatatgttcccatcggtcggcatcaccgccgccgatgtcgaatcaagctgggccggcgtc
cgcccgctcatttatgaagaggggaaagatccgtcggaaatttcccggaaagacgaaatt
tggacatcgccgtccgggctcattacgatcgccggcggcaagctgaccggctaccggaaa
atggcggaaacggtcgtcgatcttatcgccgagcaactagccaaagaagagggaaaaacg
ttccggtcgtgccagacgaaacagctgccgatctccggcggcgatgtcggcggctcgcac
cgattgccagcgttcattgccaaaaaagcggaggaagcagtgcgttacgggctgacaaaa
gaagaaggggcgcggctcgcgaaacaatacggcacgaacgtggaccgactgtttgtttta
aacaggcaatacgaccgctcggccggcttaacgcgggagacgtttatccgcctcgtttac
gcgatcgaggaagaaatggccgtcaaaccgaccgactacttcatccgccgcaccggtgcg
ctgttgtttgacatcgattcggttcgccgggaaaaagaagcggtcatcgcgttcatggcc
cgctatttgcgctggacaggggaacagacggcaacgtatgcgaaagaactggaacaagcg
ctgcgccaagcggtgttggcagaagaaggtgatgatcggaggattgtgaataaatag

DBGET integrated database retrieval system