KEGG   Geobacillus subterraneus: GS3922_05905Help
Entry
GS3922_05905      CDS       T04323                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
gsr  Geobacillus subterraneus
Pathway
gsr00061  Fatty acid biosynthesis
gsr00780  Biotin metabolism
gsr01100  Metabolic pathways
gsr01130  Biosynthesis of antibiotics
gsr01212  Fatty acid metabolism
Module
gsr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GS3922_05905
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GS3922_05905
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    GS3922_05905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gsr01004]
    GS3922_05905
Enzymes [BR:gsr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     GS3922_05905
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     GS3922_05905
Lipid biosynthesis proteins [BR:gsr01004]
 Fatty acid synthase
  Component type
   GS3922_05905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AMX83250
UniProt: A0A143MGX4
LinkDB All DBs
Position
1186454..1187230
Genome map
AA seq 258 aa AA seqDB search
MTLSLEGRTYVVMGVANKRSIAWGIARSLHAAGARLVFTYAGERFEKEVRTLVDTLEDER
SLLLPCDVANDEDIAQCFAQIKERVGVIHGVAHCIAYANKDDLSGEYMKVSRDGFLLAHN
ISAYSLTAVAREAKELMTEGGSIVTLTYLGGERVVQNYNIMGVAKASLDASVKYLANDLG
KYGIRVNAISAGPIRTLSAKGVGDFNTILKQIEERAPLRRTTTQEEVGDAALFLFSDLSR
GITGEIIHVDSGYHILGY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacattatcattggaaggacgtacatatgtcgtcatgggagtggcaaacaagcggagc
atcgcttggggcatcgcccgctcgctccacgccgccggcgcccgtctcgtgtttacatac
gccggagagcgctttgaaaaggaagtgcggacgcttgtcgacacgcttgaagatgaacgt
tcgcttctgttgccgtgcgatgtggcaaacgacgaggacatcgctcaatgctttgcgcaa
attaaagaacgggtcggcgtcattcacggtgtcgcccactgcatcgcctatgccaataag
gacgacttaagcggcgaatatatgaaagtgagccgcgacggctttttgctcgcccataac
atcagcgcctattccctcaccgcggtggcgcgcgaggcgaaggagctcatgaccgagggg
gggagcatcgtcactctgacgtacttaggcggcgagcgcgtcgtgcaaaactataacatc
atgggtgtggcgaaagcgtcgctcgatgcgagcgttaaatatttggcaaacgatttaggc
aaatacggcattcgcgtcaacgccatttctgccggaccgatccgcacgctgtcagcgaaa
ggggtcggcgactttaatacgattttaaagcaaatcgaggagcgcgccccgctccgccgg
acgacgacccaagaagaagtcggcgatgcagcgctgtttttgttcagtgacctgtcgcgc
ggcatcaccggggaaatcatccacgtcgattccgggtatcacattttaggatattaa

DBGET integrated database retrieval system