KEGG   Geobacillus subterraneus: GS3922_10650Help
Entry
GS3922_10650      CDS       T04323                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gsr  Geobacillus subterraneus
Brite
KEGG Orthology (KO) [BR:gsr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gsr01001]
    GS3922_10650
Enzymes [BR:gsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GS3922_10650
Protein kinases [BR:gsr01001]
 Serine/threonine kinases: Other
  Bacterial family
   GS3922_10650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Kdo Seadorna_VP7 Haspin_kinase RIO1 PIP49_C FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AMX85295
UniProt: A0A143MMP5
LinkDB All DBs
Position
complement(2174830..2176800)
Genome map
AA seq 656 aa AA seqDB search
MLIGKRLNDRYKIISLVGGGGMANVYLARDIILERDVAVKVLRLDFANDDQFIKRFRREA
QAATSLNHEHIVSIYDVGEEEGVYYIVMEYVRGSTLKQYIQQHAPLPVEQALRIMDQLTS
AIAHAHENGIIHRDIKPQNILIDEHGNVKVTDFGIAVALSGTTITQTNSVLGSVHYLSPE
QARGGIATEKSDVYSLGIVMFELVTGRLPFSGESAVSIVLKHLQGETPSPKAWNPEIPQS
VENIILKAMAKDPFYRYPSAREMNEDIRTALDPSRRNEAKFTIPDDDEEATKAIPIIKRP
ESAALEQETLVYEEKANEPVKADDGLKPKRKRAWLAWLAAALLLLGAAGVSALTWIPDLV
FPKDVTMPDVINKDYDEAVEQLSALGLEIKDTIDVEDDKIEEGKVVRTDPEAGMTVKPGA
GVVIYKSVGKKKIEFPSFIGDDISVAEEELRAEGFTRITRNGRYSDKPEGTILDQYPYAG
DEVVPDETEVMFTVSLGPEKVKLKDLTGYTEKSVRDYGEDQGLRIEVAYEYSDDVSEGLV
ISQTPAAGEQVAKGETITVVISRGPEPKPSKTVIKDIAIPYEPAENGQMVEAQLYIQDAN
HNMTTPYKTYRLTHPVTETVEFEIPYGETAYYRVIVNNVVKDEGAIPYPENGGKKE
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
gtgctcattggaaaacgattgaatgatcgctataaaatcatcagcctcgtcggcggcggc
ggcatggccaacgtctatttagcccgcgacatcattttggaacgcgatgtcgctgtcaaa
gtgcttcgccttgattttgccaacgatgaccaatttattaaacggtttcgccgtgaagcg
caggcggcaacgagcttaaaccatgaacatatcgtctccatttatgacgtcggtgaagag
gaaggcgtctattatatcgtcatggagtatgtgcgcggctcgacgctcaagcaatacatt
cagcagcacgccccgcttccggtcgaacaggcgctccgcatcatggaccagctgacctca
gcgatcgcccatgcgcatgagaacggcatcatccaccgcgacattaaaccgcaaaatatt
ttgatcgatgagcatggcaatgtgaaagtcaccgacttcggcatcgctgtagcgctgagc
gggacgacgatcacacaaacgaattcagtgctcggttcggttcattatttgtcgccggaa
caggcgcgcggcggcatcgccacggaaaagtcggacgtgtattcacttggcatcgtcatg
tttgaactcgtcaccggccggctgccattttccggcgaatcggccgtttcgatcgtgcta
aagcacttgcagggggaaacgccgtcgccgaaggcgtggaatccggagattccgcaaagc
gtggaaaacattattttaaaagcgatggcgaaagatccgttttatcgctatccatccgcg
cgtgaaatgaacgaggatatccggacggcgcttgatccaagccggcgcaatgaggcgaag
tttacgattcccgatgatgacgaagaggcgacgaaagccattccgattataaaacgaccg
gaaagcgcggcgctagagcaagagacgctcgtttatgaggaaaaagcgaacgaaccggtg
aaggcggacgacgggctgaagccgaaacggaagcgggcgtggctcgcctggcttgcggct
gccttgctgctgttaggcgcagctggcgtaagcgcgctgacttggattccagatcttgtc
tttccgaaagacgtgaccatgcctgatgtcatcaataaagattacgatgaagccgttgaa
cagctgtcggcgctcggcctcgaaattaaggatacgatcgatgtggaagatgataaaata
gaagaaggaaaagtcgtgcgcaccgatccggaagccggcatgacggtgaagccgggggcc
ggcgtcgttatttataagagtgtcggaaaaaagaaaatcgaatttccgagctttattggc
gatgatatttcggtggcggaagaggagttgcgcgccgaaggatttacccgcattacgcgc
aatggccgctacagcgacaaaccggaagggacgattttggatcaatacccgtacgccggc
gatgaagtcgtaccggatgaaacagaagtcatgtttaccgtcagcttagggccggaaaaa
gtgaagctcaaagatttgaccggctacacagagaagagcgtgcgcgactacggcgaagac
caagggctgcgcatcgaagtggcgtatgaatattccgatgatgtgtcggaagggcttgtc
atttcgcaaacgccggcggcaggcgaacaggtggcaaaaggtgaaaccatcacggtcgtt
atttcccgcggtccggagccgaagccgtcaaaaacggtgattaaagacatcgccattccg
tacgaaccggcggaaaacgggcaaatggtcgaagcgcagctgtacattcaagacgccaac
cataatatgacaacgccatataaaacgtatcggctgacacatccggtgacagagacggtt
gagtttgaaattccgtatggggagacggcctattaccgcgtcattgtcaacaatgtcgtc
aaagatgaaggggcgattccgtatccagaaaacggcgggaaaaaggagtga

DBGET integrated database retrieval system