KEGG   Geobacillus subterraneus: GS3922_11385Help
Entry
GS3922_11385      CDS       T04323                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
gsr  Geobacillus subterraneus
Pathway
gsr00020  Citrate cycle (TCA cycle)
gsr00310  Lysine degradation
gsr00380  Tryptophan metabolism
gsr01100  Metabolic pathways
gsr01110  Biosynthesis of secondary metabolites
gsr01120  Microbial metabolism in diverse environments
gsr01130  Biosynthesis of antibiotics
gsr01200  Carbon metabolism
Module
gsr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gsr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GS3922_11385
  09105 Amino acid metabolism
   00310 Lysine degradation
    GS3922_11385
   00380 Tryptophan metabolism
    GS3922_11385
Enzymes [BR:gsr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     GS3922_11385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AMX84215
UniProt: A0A143MJN5
LinkDB All DBs
Position
complement(2323814..2326669)
Genome map
AA seq 951 aa AA seqDB search
MAKQTNYAQPWSQFYGPNLGYVIEMYEQYLDDPDSVDPELKQLFEQWGAPVVEEPVSPAD
HEAAQTHQTFRLPETPTVFSKLVAAVKLADSIRHYGHLAADTNPIVKEEKKLRRLELDEY
DLTEEDLKRIPVAFLCPHAPAHVKNGWDAIMHLRKIYTDKIAFEFSQVHNLEERNWLIQQ
IESGAYYPSLANKERVALLRRLTEVEGFEKFIHRTYVGQKRFSIEGLDAMVPLLDELVRQ
AIEQEIDAVNIGMAHRGRLNVLAHVLGKPYEMIFAEFQHAESKNFIPSEGAVAITYGWTG
DVKYHLGAARRLRNQSAHTMRITLANNPSHLEVVNPVVLGYTRAAQEDRTKPGVPEQKTE
ASFAILIHGDAAFPGQGIVAETLNLSQLRGYTTGGAIHIIANNMIGFTTESYDSRSTTYA
SDMAKGFEVPIVHVNADDPEACLAAASLAFAYRQRFKKDFVIDLIGYRRFGHNEMDEPMA
TNPIMYSIIHQHPTVRELYAQKLIEKGIIAEQEVEEMEQEVAERLKIAYERVPKSEEELD
FIMDPPKPVVARLPEVKTGVAKDVLHRINEELLEFPADFHVFNKLERILKRRSGVFMQNG
KIDWAHAETLAFATILQDGVPIRLTGQDSQRGTFAQRHLVLHDVKTGKEYVPLHHISGAK
ASFVVYNSPLTEAAVLGYEYGYNVYAPETLVLWEAQFGDFANMAQVMFDQFISSGRAKWG
QKSGLVMLLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANLSTAAQYFHILRRQAALLQ
KEEVRPLVLMTPKSLLRHPLAASDAEALVHGVFSPVLEQPGLGTDPSKVERIVFGTGKLM
IDLAEQIGKMEGLDWLHVVRVEELYPFPEEAVQAIIARYPNVKELVWVQEEPKNMGAWTY
MEPRLRALAPDGVDVSYIGRRRRASPAEGDPVVHRKEQERIIRCALTKYER
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacagacgaactacgctcaaccgtggagccagttttacgggccgaacctcggc
tatgtcatcgaaatgtacgaacagtatctcgatgacccggacagcgtcgatccggaacta
aaacaattgtttgaacaatggggggcgccggtcgtcgaggagccggtttctcctgcggat
cacgaagcggcgcagacgcatcaaacgttccggctgccggaaacaccgaccgtgttcagc
aagcttgtcgccgccgtcaaattggcggacagcattcgccattatggccatctggccgcc
gatacgaacccgattgtgaaagaggagaaaaagctgcgccgcctcgaacttgatgagtat
gatttgacggaggaagatttaaagcgcattccggtcgcatttctttgtccgcatgccccg
gcgcatgtcaaaaacggctgggatgccatcatgcacttgcgcaaaatctatacagataaa
atcgcctttgaattctcgcaagtacataatctagaggaaaggaactggctcatccagcaa
atcgagtccggagcgtactatccgagcttggcgaacaaagagcgggtcgccttgttgcgc
cgcctgacggaagtggaggggtttgaaaaattcatccaccggacgtatgtcgggcaaaag
cgcttttcgattgagggacttgacgccatggtgccgctccttgatgagcttgttcgccag
gcgatcgaacaggagattgacgccgtcaacatcggcatggcgcaccgcggccggctgaac
gtgcttgcgcatgtgcttggcaagccgtatgaaatgattttcgccgagtttcagcatgcg
gagagcaaaaactttattccgtctgaaggagcggtggccatcacctacggctggacgggc
gacgtgaaataccatttgggggcagcgcgccggctacgcaatcaaagcgcccatacgatg
cgaattacgctcgccaacaacccgagccatcttgaagtcgtcaatccggtcgtgctcggt
tatacgcgcgccgcgcaagaagaccggaccaaaccgggcgtgccggagcaaaagacagag
gcttcgtttgccattttaattcatggcgatgctgctttcccggggcaaggcattgtggct
gaaacgctcaacttaagccagctgcgcggctatacgaccggcggagccattcatattatc
gccaacaacatgatcggctttacgacggaaagttacgattcccgttcgacaacgtatgct
tctgatatggcgaaagggtttgaagtgccgattgtgcatgtcaatgccgacgatccggag
gcctgcctggcggcggcaagcttggcgtttgcgtatcgccagcggtttaaaaaagatttt
gtcatcgacttgatcggctatcgccgcttcggccataacgaaatggatgagccgatggcg
acgaacccgatcatgtacagcatcattcaccagcatccgaccgtgcgcgagctgtatgcg
caaaagctgattgaaaaggggatcatcgccgagcaggaagtcgaagaaatggaacaggaa
gtggccgaacggttgaaaattgcttatgaacgggtgccgaaaagtgaagaggaactcgat
ttcattatggatccaccgaaaccggtcgtcgctcggcttccggaagtgaaaacaggcgtg
gcgaaagacgtgcttcaccgcatcaatgaggagctgctcgagttcccggctgacttccat
gtctttaacaagcttgagcgcattttaaagcggcgcagcggcgtatttatgcaaaatggc
aaaatcgactgggcgcacgcggaaacgttggcgtttgcgacgattttgcaagatggcgtg
ccgatccgcctcaccggccaagattcacagcgcggcacgtttgcccagcgccatttagtg
ctgcacgatgtgaaaacgggcaaagagtacgttccgcttcatcatatcagcggcgcgaaa
gcttcgtttgtcgtttacaacagcccgttgactgaggcggctgtgctcggttatgaatac
ggctacaacgtgtacgcaccggaaacgctcgtgctttgggaagcgcagtttggcgatttc
gccaacatggcgcaagtcatgtttgaccagtttatctcgtcgggacgggcaaaatggggg
caaaagtccgggctcgttatgctcttgccgcacggttatgaagggcaagggccggaacat
tcgagcggccgcgtcgagcggtttttgcagctggcggcggaaaacaactggacggtcgcc
aacttgtcgacggcagcgcaatatttccatattttgcgccggcaagcggcgctgctgcaa
aaagaagaagtgcgcccgctcgtcttaatgacgccgaaaagcttgctccgtcatccgctg
gcggcatccgacgccgaagcgcttgttcatggcgtattctcgccggtgctcgagcagccg
ggattagggacggaccccagcaaggtcgagcggatcgtgtttggcactggcaagctgatg
attgatttagcggaacaaatcggcaaaatggaagggcttgactggctgcatgtcgtgcgc
gttgaagagctgtatccgttcccagaagaagcggtgcaggcgattatcgcgcgttacccg
aacgtaaaagagctcgtttgggtgcaagaggagccgaaaaacatgggcgcttggacgtat
atggagccgcgcctgcgggcccttgctccagacggcgtcgatgtcagctatatcgggcgg
cgccggcgggcgagtccggcggaaggcgatccggtcgtccaccggaaagagcaggagcgc
attattcgctgtgcattaacgaaatatgaacgatga

DBGET integrated database retrieval system