KEGG   Geobacillus subterraneus: GS3922_12375Help
Entry
GS3922_12375      CDS       T04323                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gsr  Geobacillus subterraneus
Pathway
gsr00010  Glycolysis / Gluconeogenesis
gsr00071  Fatty acid degradation
gsr00350  Tyrosine metabolism
gsr00625  Chloroalkane and chloroalkene degradation
gsr00626  Naphthalene degradation
gsr01100  Metabolic pathways
gsr01110  Biosynthesis of secondary metabolites
gsr01120  Microbial metabolism in diverse environments
gsr01130  Biosynthesis of antibiotics
gsr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gsr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GS3922_12375
  Lipid metabolism
   00071 Fatty acid degradation
    GS3922_12375
  Amino acid metabolism
   00350 Tyrosine metabolism
    GS3922_12375
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GS3922_12375
   00626 Naphthalene degradation
    GS3922_12375
Enzymes [BR:gsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GS3922_12375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_11 2-Hacid_dh_C Methyltransf_25 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AMX84394
UniProt: A0A143MK25
LinkDB All DBs
Position
2535060..2536079
Genome map
AA seq 339 aa AA seqDB search
MKAAVVEQFKEPLKIKEVKKPTISYGEVLVRIKACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIIEEVGPGVTHLKVGDRVGIPWLYSACGHCEYCLSGQETLCEHQENAGYSVDGGY
AEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKALKVTGTKPGEWVAIYGIGGLGHVA
VQYAKAMGLNVVAVDIGDEKLKLAKELGADLVVNPMKEDATQFMKEKVGGVHAAVVTAVS
KPAFKSAYNSIRRGGTCVLVGLPPEEMPIPIFDTVLNGIKIIGSIVGTRKDLQEALQFAA
EGKVKTIIEMQPLEKINEVFDRMLKGEINGRVVLTLEDQ
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtagtggaacaatttaaggaaccattaaaaataaaagaggtgaaaaaa
ccaaccatttcatatggagaagtattagtccgcattaaagcatgcggtgtatgccatacg
gacttgcatgccgctcacggtgattggccagtaaaaccaaaactccctttaatccccgga
catgaaggagttgggattatcgaagaagtaggtccgggcgtaacccatttaaaagtgggg
gatcgcgttggaattccttggttatattctgcttgcggacattgtgaatattgtttaagc
ggacaagaaacattatgcgagcaccaagaaaacgctggctactcagtcgatggggggtat
gcagaatattgtagagctgcggcagactatgtggtcaaaattcctgacaacttatcgttt
gaagaagctgctccaattttctgtgccggagttactacctataaagcgttaaaagtaaca
ggtacaaaacctggagaatgggtagcgatctacggtatcggcggccttgggcacgttgcc
gttcaatacgctaaagcgatgggacttaatgtcgttgcagtggatatcggcgatgaaaaa
cttaaacttgcaaaagagcttggcgctgatcttgttgtaaaccctatgaaagaagatgcg
acgcaatttatgaaagagaaagttggcggagttcacgcggcagttgtaacagctgtatct
aaaccagcctttaaatctgcgtacaattctattcgcagaggcggtacgtgcgttcttgtc
ggattgccgccggaagaaatgcctattccaatttttgataccgtactaaacggaattaaa
attattggctctattgtcggtacacggaaggacttgcaagaagctctccaattcgctgcg
gaaggtaaagtaaaaaccattattgaaatgcaacctcttgaaaaaattaatgaagtattt
gacagaatgctaaaaggtgaaattaacggacgggttgttttaacgttagaagatcaataa

DBGET integrated database retrieval system