KEGG   Geobacillus subterraneus: GS3922_12480Help
Entry
GS3922_12480      CDS       T04323                                 

Definition
(GenBank) alpha-amlyase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
gsr  Geobacillus subterraneus
Pathway
gsr00500  Starch and sucrose metabolism
gsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GS3922_12480
Enzymes [BR:gsr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GS3922_12480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase GHL10 Malt_amylase_C Glyco_hydro_66 NifT
Motif
Other DBs
NCBI-ProteinID: AMX84412
UniProt: A0A143MKM9
LinkDB All DBs
Position
complement(2563688..2565223)
Genome map
AA seq 511 aa AA seqDB search
MGNRLVVLFILPFLLFYAMPATAAEKEERTWQDEAIYFIMVDRFNNMDPTNDQDINVNDP
KGYFGGDLKGVTAKLDYIKEMGFTAIWLTPIFENMPGGYHGYWIKDFYRVDPHFGTLDDL
KTLVKEAHKRHMKVILDFVANHVGYDHPWLRDPAKKDWFHPKKEIFDWNDQTQLENGWVY
GLPDLAQENPEVKKYLIDAAKWWIKETDIDGYRLDTVRHVPKSFWQEFAKEVKSVKQDFF
LLGEVWSDDPRYIAEYGQYGIDGFVDYPLYGAVKQSLARRDASLRPLYDAWEYNKTFYDR
PYLLGTFLDNHDTVRFTKLSIDNRNNPISRIKVAMTYLFTAPGIPIMYYGTEIAMNGGPD
PDNRRLMDFRADPEIIDYLKKIGPLRQQLPSLRRGDFTLLYEKDGMAVFQRRYKEETTVI
AINNTGETQHVHLTNDQLPKNKELRGFLLDDLVRGDEDGYDLVLERETAEVYKLREKTGV
NVPFIATLVAVYALFILFLYMVKKRAKRADE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccgtcttgttgtactgttcatccttccgttccttcttttttatgccatgccg
gctacggcggcggaaaaagaagaacggacgtggcaagatgaagcgatttatttcattatg
gtcgaccgtttcaacaatatggatccgacgaacgaccaagacatcaatgtcaacgaccca
aaaggatattttggcggtgatttaaaaggggtgacagcgaagctcgattatattaaggaa
atggggtttaccgccatttggctgacgccgatttttgaaaacatgccgggcggctatcat
gggtattggatcaaagatttttatcgcgttgatccgcatttcggcacgctggatgatttg
aagacgcttgtcaaagaagcgcacaagcgccatatgaaagtcatcttggactttgtcgcc
aaccatgtcggctacgaccatccatggcttcgcgacccggcgaaaaaagattggttccat
ccgaaaaaagagattttcgactggaatgatcaaacacaactagaaaacggatgggtgtat
gggctgccggatttagcgcaggaaaatccagaagtcaagaaatatttaatcgatgcggcc
aaatggtggatcaaagaaacggacattgacggctatcgcctcgatacggtgcgccatgtg
ccaaaatcattttggcaggagttcgccaaagaagtgaaatcggtgaaacaagactttttc
cttcttggcgaagtgtggagcgacgatccgcgctatattgccgagtacggccaatacggc
atcgacggttttgtcgattatccgctgtatggcgcggtgaagcagtcgcttgctaggcgc
gatgcatcgctccggccgttgtatgacgcctgggaatacaacaaaacgttttacgaccgc
ccgtacttgctcgggacgtttttggacaatcacgataccgtgcggtttacgaaactttcg
attgacaaccgcaacaatccgatttcgcgcattaaggtagcgatgacgtatttgttcact
gctccgggcattccgatcatgtactacggaacggaaatcgcgatgaacggtggtccggac
ccggataaccgccgattgatggacttccgggctgatccggaaattatcgattatttaaag
aaaatcggcccgctccgccagcagctgccgtcgttgcggcgcggcgattttacgctcttg
tatgagaaagacggcatggcggtgtttcaacgccggtacaaagaggaaacgacggtcatt
gccattaacaacacgggcgaaacgcagcacgtccatttaacgaatgaccagctgccaaaa
aacaaggaattgcgcggttttttgctcgatgacctcgtccgcggcgatgaagacggctac
gatcttgtattggaacgcgaaacggcggaagtgtacaagctgcgggaaaaaacgggggtg
aacgtgccgtttatcgccacgctagtcgcggtttacgcgctattcatcttgtttttatac
atggtgaaaaaacgagccaaacgggcagatgaataa

DBGET integrated database retrieval system