KEGG   Geobacillus subterraneus: GS3922_12625Help
Entry
GS3922_12625      CDS       T04323                                 

Definition
(GenBank) competence protein ComK
  KO
K02250  competence protein ComK
Organism
gsr  Geobacillus subterraneus
Pathway
gsr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gsr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GS3922_12625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gsr03000]
    GS3922_12625
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gsr02044]
    GS3922_12625
Transcription factors [BR:gsr03000]
 Prokaryotic Type
  Other transcription factors
   Others
    GS3922_12625
Secretion system [BR:gsr02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   GS3922_12625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK Tegument_dsDNA
Motif
Other DBs
NCBI-ProteinID: AMX84439
UniProt: A0A143MK71
LinkDB All DBs
Position
complement(2599972..2600517)
Genome map
AA seq 181 aa AA seqDB search
MKVNEFIVLKHFVVSRYTMAILPYLLNSDVYAKVIEEDGEYIVKKTPTDIIKHSCDYYGC
SFQGRKEGTKALIGITHKAPIAIEPANGIYVFPTSSPRDSGCVWLSHMHVYQYEPAKYER
TVVYFRNGKSVSLDVSYKSFVNQLYRTAQLRTKLADRMEARERKLQYLFRMQQEKDVTEH
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaatgagtttatcgtgttgaaacatttcgtcgtgagccgttatactatggcg
attctcccgtacctgttgaacagtgatgtctatgcaaaggtcattgaggaagacggcgaa
tatattgtcaaaaaaacgccaaccgatatcattaaacatagctgcgactattacggctgc
agcttccaaggcagaaaagaaggaacaaaggcgttgatcggcatcacccacaaagcgccg
attgccatcgaaccggccaatggaatttacgtcttcccgacttcttccccaagagattcc
ggctgcgtttggctgtcccatatgcacgtctatcagtatgaacctgccaaatatgagcga
accgtcgtctatttccgcaatggaaaaagcgtatccctcgatgtttcctataaatccttt
gtcaatcaattatatcgaacagcccaactgcggacgaaattggcggatcgaatggaggcg
agagaacgcaaactccaatacctattccgcatgcagcaggaaaaagatgtgacagagcat
gaatga

DBGET integrated database retrieval system