KEGG   Geobacillus subterraneus: GS3922_14570Help
Entry
GS3922_14570      CDS       T04323                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gsr  Geobacillus subterraneus
Pathway
gsr00473  D-Alanine metabolism
gsr01100  Metabolic pathways
gsr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gsr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GS3922_14570
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    GS3922_14570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gsr01011]
    GS3922_14570
Enzymes [BR:gsr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GS3922_14570
Peptidoglycan biosynthesis and degradation proteins [BR:gsr01011]
 Precursor biosynthesis
  Racemase
   GS3922_14570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AMX84760
UniProt: A0A143ML86
LinkDB All DBs
Position
complement(3009070..3010224)
Genome map
AA seq 384 aa AA seqDB search
MDDFHRDTWAEIDLDAIYDNVANLRRFLPDGTRVMAVVKANAYGHGDAQVAETALEAGAS
YLAVAFLDEALALRKKGINAPILVLGASRPADVTLAAQHRIALTVFRADWVEEASSIYTD
SAPVHFHLKMDTGMGRLGVKNEEETKRIMALIDRHPSFILEGAYTHFATADEVNTDYLSY
QYGRFLRMLEWLPSRPPLVHCANSAAALRFPDRAFNMVRFGISMYGLAPSPSIKPLLPYE
LKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQVEEWIGTIPIGYADGWLRRLQHFHVLVN
GQRAPIVGRICMDQCMIRLPGPLPIGTKVTLIGRQGDEAISVDDVARQLETINYEVPCTI
SYRVPRIFFRNKRIMEVRNAVCHG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacgactttcaccgcgatacgtgggcggaaattgatttggatgccatttacgacaac
gttgcgaatttgcgccgctttttgccggatggaacgcgggtgatggccgtcgtgaaggcg
aacgcctatggacatggtgacgcccaagtggcggaaacggcgctagaagccggcgcttcc
tacttagccgtcgcctttttggacgaggcgctcgccttaaggaaaaaaggcatcaatgcg
cccattttagtgctcggggcgtcccgcccggccgatgtgacgctagccgcccaacatcgc
attgccttaaccgtgtttcgcgctgattgggtagaagaggcgtcatccatttacacggac
tcggccccggttcactttcatttgaaaatggacaccggaatgggaaggctcggggtgaaa
aacgaagaggagacaaagcgcatcatggcgctgattgatcgccacccgtcctttatcctt
gaaggggcatatacgcattttgcgacggctgatgaagtgaatacagactatctttcttac
caatatggccgctttttgcgtatgctcgaatggctgccgtcgcggccgccgctcgttcat
tgtgccaacagcgcagcggcgctccgctttcccgatcgagcgttcaatatggtccgcttc
ggcatttccatgtacgggctcgctccgtcgccaagcatcaagccgctgcttccatacgaa
ctcaaggaggcgttttcgctccatagccgcctcgtgcatgtgaaaaagctgcagccgggg
gaaaaggtcagttacggagcgacgtataccgcgcaagtggaagagtggatcggcacgatc
ccgatcggctatgcggacggctggctccgtcgtctgcaacattttcatgtgctcgtgaac
gggcaaagggcgccgattgtcggccgcatttgcatggatcaatgcatgatccgcctgcct
gggccgctgccgatcggcacgaaggtgacgttgattggtcgtcaaggggatgaagccatc
tcagtcgatgatgtcgcccgccagttggaaacgattaattacgaagtgccttgcacaatc
agttatcgggtgccccgtatttttttccgaaataagcgtataatggaagtgagaaatgct
gtttgtcacgggtga

DBGET integrated database retrieval system