KEGG   Bacillus sp. X1(2014): HW35_01470Help
Entry
HW35_01470        CDS       T03242                                 

Definition
(GenBank) Type II restriction endonuclease BstXII
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
gst  Bacillus sp. X1(2014)
Brite
Enzymes [BR:gst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     HW35_01470
Prokaryotic defense system [BR:gst02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    HW35_01470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII
Motif
Other DBs
NCBI-ProteinID: AIM15130
UniProt: A0A077J305
LinkDB All DBs
Position
complement(276122..277054)
Genome map
AA seq 310 aa AA seqDB search
MKRLGFYNKVLNCNNEDEVFNFLINHLKETIKSWDYFVNWDKVKSNVLNIEVGLNILNTL
IGKENPKDVFINLIKEYPNVISCIPILLATRDTEMVVLNPNENNIFSYEKYSFKKLLKVS
DEEAIKYANFLEKTGFFQLIKNKEIKNLVDYVYGVEVGLDSNGRKNRSGTSMEKLTELYV
NRACNKLGFTYITQANSNEIKNKFNETIVVDKNERRFDFVVKTNSNLILIETNYYGGGGS
KLKATAGEYKALYDFTKMKNTNADFIWITDGKGWLTSKNPLRETFDHTDYIFNLDMLQKG
ILEYIFSKFS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagactaggtttttataacaaagtattaaattgtaataatgaagatgaggttttt
aacttcctaataaaccacttaaaagaaacaataaaaagctgggattattttgttaattgg
gacaaagtcaaatctaatgtattaaatattgaggttggcttaaatattctgaatacttta
attggtaaagaaaatccaaaggacgtttttataaatttaataaaggagtacccgaatgtt
atttcatgtatccccattttacttgcaactagggatacagaaatggttgtattaaatccc
aatgaaaataacatatttagttatgaaaaatattccttcaaaaaattactaaaagtttct
gatgaggaagctattaaatatgcaaattttctagaaaaaacagggttctttcaattaatt
aaaaacaaggaaattaagaatttagtagattatgtatatggtgtagaagttgggcttgat
tcaaatggacgaaaaaatcgttctggaacgagcatggaaaaattaacggagttatatgta
aatagggcatgtaataagctggggtttacttatataacccaagctaattcaaatgaaata
aaaaacaaatttaatgaaacaatcgttgttgataagaacgaaagaagatttgattttgta
gtaaaaactaatagtaacttaatattaatagaaacaaattattatggaggaggaggttct
aagttaaaagcaactgcaggagaatataaggctttgtatgattttacaaaaatgaaaaat
acaaatgctgattttatttggattacagatgggaaagggtggttaacatcaaaaaatcca
ttacgcgaaacgtttgatcatactgattatatatttaatctagacatgttgcaaaaaggt
attttggaatacatttttagtaaattttcataa

DBGET integrated database retrieval system