KEGG   Bacillus sp. X1(2014): HW35_05665Help
Entry
HW35_05665        CDS       T03242                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gst  Bacillus sp. X1(2014)
Pathway
gst00020  Citrate cycle (TCA cycle)
gst00480  Glutathione metabolism
gst01100  Metabolic pathways
gst01110  Biosynthesis of secondary metabolites
gst01120  Microbial metabolism in diverse environments
gst01130  Biosynthesis of antibiotics
gst01200  Carbon metabolism
gst01210  2-Oxocarboxylic acid metabolism
gst01230  Biosynthesis of amino acids
Module
gst_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gst_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HW35_05665
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HW35_05665
Enzymes [BR:gst01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     HW35_05665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIM15868
UniProt: A0A077J831
LinkDB All DBs
Position
complement(1069818..1071086)
Genome map
AA seq 422 aa AA seqDB search
MQGEKITVTNGVLNVPNNPIIPFIEGDGTGPDIWAAANRVLDAAVEKAYKGERKLVWKEV
LAGEKAFNQTGEWLPQETLDVIREYLIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLRP
VRWFEGVPSPVKRPQDTDMVIFRENTEDIYAGIEYEKGSEAVKKVINFLQNEMGVKKIRF
PETSGIGIKPVSEEGTHRLVRAAINYAIKEGRKSVTLVHKGNIMKFTEGAFKNWGYELAE
REFGDKVFTWAQYDRIKEEQGTEAANKAQAEAEAAGKIIIKDAIADIFLQQILTRPREFD
VVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPSS
VILSGVLMLEHLGWNEAASLIIKAMEKTISSKVVTYDFARLMDGATEVKTSEFADELIKN
ME
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcgaaaaaatcacggttacaaatggtgtattaaacgttccaaacaatcctatt
attccgttcattgaaggagacggtacaggtcctgatatttgggcagctgctaaccgcgta
ttggatgctgcggttgaaaaggcgtacaagggagagcgtaagctcgtttggaaagaagtt
ttggctggtgagaaagcgttcaatcaaactggtgaatggcttcctcaagaaactctagat
gtaattagagaatatttgattgctatcaaaggtccattaacgactccagttggtggagga
attcgttcattaaacgttgcgttacgccaagaattagatctttttgtgtgcttgcgtcca
gtaagatggtttgaaggagtaccttccccagttaagcgtccgcaagacacagatatggtt
attttccgtgaaaatactgaagacatttatgcaggtattgaatatgaaaaaggctcagaa
gcagttaagaaagttattaacttcctgcaaaatgaaatgggagttaagaaaattagattc
cctgaaacttccggtatcggaattaagcctgtttctgaagaaggtacacatcgtttagtt
cgtgcggctattaattatgctattaaagaaggacgtaaatctgttactcttgttcataaa
gggaatatcatgaaatttactgaaggtgcgtttaagaactggggatatgagcttgctgaa
agagagttcggcgataaagtattcacttgggctcaatatgaccgtatcaaggaggaacaa
ggtacagaagcggcaaacaaagcacaggctgaagcagaagcagccggtaaaatcattatt
aaagatgcaatagctgatatcttcctacagcaaatcctgactcgtccacgtgagtttgat
gtagttgcaacgatgaacctaaacggtgattatatctctgacgcactagcagcacaagta
ggtggaattggtatcgcacctggtgctaacatcaactatgaaacaggacatgcaattttt
gaagcgacacatggtacagcacctaagtatgctggtttagataaggtaaacccttcttct
gtcatcctttccggtgttttaatgcttgagcatttaggctggaatgaagcagctagcttg
atcattaaggcaatggagaaaaccatttcgtctaaagtggtaacttacgactttgcccgt
ttaatggatggtgcaacagaagtaaaaacttctgaatttgcagatgaattaattaagaac
atggaataa

DBGET integrated database retrieval system