KEGG   Bacillus sp. X1(2014): HW35_06200Help
Entry
HW35_06200        CDS       T03242                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gst  Bacillus sp. X1(2014)
Brite
KEGG Orthology (KO) [BR:gst00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HW35_06200
Enzymes [BR:gst01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HW35_06200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C DAO NAD_binding_7 FAD_binding_3 Thi4 Glutaredoxin K_oxygenase Thioredoxin_4 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AIM15966
UniProt: A0A077J5M9
LinkDB All DBs
Position
1181832..1183361
Genome map
AA seq 509 aa AA seqDB search
MLLDAEIKSQLAQYLQMMEGDVLLKVSTGSDKVSQDMLSLVDELATMSSHIKVEKTELER
TPSFSINRPGEDTGITFAGVPLGHEFTSLVLALLQVSGRAPKVDQKAIEQIKNIKGEYHF
ETYVSLTCHNCPDVVQALNVMSVLNPGISHTMIDGAAYKEEVESKNIMAVPTVFLNGEPF
GSGRMSLEEILAKIGSGPDASELSNKEPFDVLVIGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTLGIENLIGTKYTEGPKLAASLEEHVKEYDIDIMNLQRAKRLEKKDLIEVELE
NGAVLKSKTVILSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADKVLQERLYSLPNVTVIKNAQTKEITGTDKVNGITY
IDRETGEEHHIELQGVFVQIGLVPNTEWLEGTVERTRFGEIIVDKHGATSLPGVFAAGDC
TDSAYKQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttactagatgcagaaatcaaatcacaattagcccaatatcttcaaatgatggaaggc
gatgtgctgcttaaagtaagtactggctctgataaagtatctcaagacatgctctccctt
gtggatgaattggctactatgtcatctcacattaaagtagagaaaacagagttagagaga
acgccaagctttagcattaatcgacctggcgaagacactggcatcacttttgccggtgtc
ccgcttggacatgaatttacctctttagttctagctctacttcaagttagtggaagagct
ccaaaagttgatcaaaaggctattgaacaaattaagaatatcaaaggtgaatatcacttt
gagacctatgtaagtttaacatgtcacaattgtcctgatgtagtgcaggcattaaacgtc
atgagcgtcttgaaccctggcattagccataccatgattgatggtgctgcatacaaagag
gaagtagagagcaaaaacatcatggcagttccaactgttttcttaaatggtgaacctttc
ggaagcggacggatgtcccttgaggaaatccttgcaaaaataggaagcggccctgatgca
tcagaactttctaataaagaaccttttgatgtacttgttatcggtggtggtcctgctggg
gcaagtgcagccatctatgcagcacgcaaaggcattcgcacaggtattgttgctgaacgc
tttggcggccaggttatggacactcttggtatcgagaacctaattggtacgaaatacact
gaaggtccaaagcttgcagcaagccttgaagaacatgtgaaagagtacgacattgatatc
atgaacttacaacgtgccaaacgtttagaaaagaaagacctgattgaagtagaacttgaa
aatggtgctgttctaaaaagtaagaccgttattctttctactggtgcccgctggcgcaat
gtcggtgtccctggtgaagcagaattcaagaacaaaggcgtggcatattgtccacattgt
gacggtccgctatttgaaggaaaacacgttgccgttattggcggcggaaattccggtatt
gaagcggccattgatcttgcaggtatcgttaaacacgtaaccgttcttgaattcatgcca
gagttgaaagctgataaagttctgcaagaacgtctatatagccttccaaatgttacagta
atcaagaatgcacaaacaaaagaaattaccggtactgataaagtaaacggaattacctat
atcgaccgcgaaacaggggaagaacaccatattgaactacaaggtgtctttgttcaaatc
ggacttgtccctaataccgaatggttagagggtaccgtagaacgcactcgtttcggtgaa
atcatagtcgataagcatggtgctacatcccttcctggtgtatttgcagcaggtgactgt
actgacagtgcctacaagcaaattattatctctatgggatctggtgctactgcagcattg
ggcgcattcgattatttaattcggaattaa

DBGET integrated database retrieval system