KEGG   Bacillus sp. X1(2014): HW35_07630Help
Entry
HW35_07630        CDS       T03242                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
gst  Bacillus sp. X1(2014)
Pathway
gst00340  Histidine metabolism
gst01100  Metabolic pathways
gst01110  Biosynthesis of secondary metabolites
gst01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gst00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    HW35_07630
Enzymes [BR:gst01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     HW35_07630
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     HW35_07630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AIM16177
UniProt: A0A077J634
LinkDB All DBs
Position
complement(1440042..1440671)
Genome map
AA seq 209 aa AA seqDB search
MIKDTVRFDEKGLVPAIIQDAETMKVLTLAYMNEESLEKTLETGETWFYSRSRQELWHKG
ATSGNTQSVVSIKYDCDQDALLIQVKPKGPACHTGAVSCFSEEAVSERSPRLANYQFLQT
LEKVIQQRYKERPEGAYTTYLFEKGLDKILKKIGEEASEVIIAAKNREHEELKWEAADLL
YHLLVLLVEQDLPFKEVLRTLEKRHKNRS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagatactgtccgatttgatgaaaaaggacttgttccagcgataattcaggat
gctgaaaccatgaaagttttaacactggcttatatgaatgaagagtcactcgaaaagacg
ttggaaacaggtgaaacatggttttatagccgctctcgccaagagctttggcataaggga
gctacaagtggcaatacccagtcggtcgtaagtatcaaatatgattgtgatcaagatgcc
ctgctcattcaagtaaaaccaaaagggccagcatgccatactggtgccgttagctgcttt
tccgaggaagccgtttccgaacgctcccctcgtcttgcgaactatcagtttttacaaacg
cttgaaaaggtcattcaacaacgttacaaggaacgaccagaaggtgcttatacaacctat
ctttttgaaaaagggcttgacaaaatcttaaaaaaaattggggaagaggcatctgaggtt
attattgccgcgaaaaaccgagaacatgaagaattaaaatgggaagctgctgatttgctc
tatcacttgctcgtattactagtcgaacaagatcttccatttaaagaagtattacggaca
ttagaaaaacgtcacaaaaaccggtcctaa

DBGET integrated database retrieval system