KEGG   Bacillus sp. X1(2014): HW35_10195Help
Entry
HW35_10195        CDS       T03242                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gst  Bacillus sp. X1(2014)
Pathway
gst00450  Selenocompound metabolism
gst00970  Aminoacyl-tRNA biosynthesis
gst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gst00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HW35_10195
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HW35_10195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gst01007]
    HW35_10195
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gst03016]
    HW35_10195
Enzymes [BR:gst01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HW35_10195
Amino acid related enzymes [BR:gst01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HW35_10195
Transfer RNA biogenesis [BR:gst03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HW35_10195
 Prokaryotic type
   Other AARSs
    HW35_10195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f zinc_ribbon_11
Motif
Other DBs
NCBI-ProteinID: AIM16594
UniProt: A0A077J514
LinkDB All DBs
Position
1963640..1965604
Genome map
AA seq 654 aa AA seqDB search
MAEKTFYITTPIYYPSGNLHIGHAYTTVAGDAMARYKRMRGYDVRYLTGTDEHGQKIQQK
AVEKGVTPQAYVDEIVAGIKDLWKKLDISYDDFIRTTEERHKKIVEKIFARLLEQGDIYL
DEYEGWYCTPCESFYTDRQLVEGNCPDCGRPVGKVKEESYFFKMSKYVDRLLQYYEENPE
FIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALSNYITALGY
GSEDDSNYLKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDGKMS
KSKGNVVDPVTLIDRYGLDSLRYYLLREVPFGADGVFTPEGFVERINFDLANDLGNLLNR
TVAMIDKYFEGIIPDYIGSVGEYDEALLQVNRDTITKYEEAMEKMEFSVALSSIWQLVSR
TNKYIDETQPWTLAKDESRRKELASVMVHLAESLRRVAILLKPFLTRTPYGIFKQLGIKD
AELMKWESLENFGLIPSGTKVEKDAPLFPRLDIAEEVEFIKTKMQGEAAQPQKQDSVEKK
EEKPEEIDEISIDDFMKIDMRVAEVIEAEPVKKADKLLKLQLDLGYEKRQVVSGIAQYYK
PQELVGRKVICITNLKPVKLRGELSQGMILAGSKDGKLSLATVDQTLPNGAKVK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaaaacattttacattaccacaccgatatattatcctagtggaaatttacat
attggacatgcgtatactacagtggccggtgatgcgatggcccgttataagcggatgagg
ggatatgatgttagatatttgactggtaccgatgagcacggtcaaaaaatccagcagaaa
gcagttgaaaaaggagttactcctcaggcttatgtagatgagattgtggccggaataaag
gatctttggaaaaagcttgatatctcttatgatgattttatccgtacaacggaagaaaga
cataaaaaaattgtcgaaaagatttttgcacgactactcgaacaaggggatatttatctt
gatgagtatgaaggctggtattgtactccgtgtgaatccttttacaccgatcgccagctc
gtagagggaaattgtcctgactgtggacgcccggtaggcaaggtaaaagaagaatcctac
ttctttaaaatgagtaagtatgtcgaccgtcttttacagtactatgaagaaaatccagaa
tttattcaacctgagtcccgaaaaaatgaaatgattaataattttattaaacctggttta
gaggatttagcggtttcaagaactacctttgattgggggattaaggtaccaggagatccg
aaacatgttatctatgtttggatagacgctctttctaactatattacagctcttggctat
ggatcagaagatgattccaattatttaaaatactggcctgcggatgtccaccttgttggg
aaggaaatcgttcgtttccatacaatttattggccaattatgttaatggccttagatttg
ccgttgccgaagaaagtttttgctcatggatggctgctgatgaaggatgggaaaatgtcg
aaatcgaaagggaatgtggtagaccctgtgacccttattgatcgctatggactcgactcc
cttcgctattatttattaagagaagtaccgtttggggcagatggtgttttcacacctgaa
ggtttcgttgaaagaattaactttgatttggcgaacgatcttggaaatctgttaaatcgt
acagtagctatgattgataaatattttgagggcatcattccggattatatcggttccgta
ggagaatatgacgaagctttgctccaagtgaaccgtgatacaatcactaagtacgaggaa
gcaatggagaagatggaattttctgttgcattgtcttctatttggcaattagtcagccgg
acaaataaatatattgatgaaacacagccatggactttggcgaaggacgaatcacgccgt
aaggaactagctagtgtaatggttcatttagctgaatctttacgtagagtggctatcctt
ttaaagcctttcttaactcggactccatatggaatttttaaacagttaggaattaaagat
gcggaattaatgaaatgggaaagccttgagaactttgggttaattcctagtggtacaaaa
gttgaaaaggatgcaccactgttccctagactagatattgccgaggaagtcgaatttata
aaaacaaaaatgcagggtgaagcggcacagcctcaaaagcaagattcagttgaaaagaaa
gaggaaaaacctgaagaaattgatgaaatctctattgatgacttcatgaaaattgatatg
agagtcgcagaggtaattgaggcagagccagtaaaaaaagctgataaattattaaaactg
cagctggatcttggctatgaaaaacgtcaggtcgtttctgggattgcccagtattacaaa
ccgcaagaattggttggtcgtaaagtaatttgtattacaaatttaaaacctgttaaactg
cgcggtgaactttcccaaggaatgattcttgctggctcaaaagatggaaagctttcactg
gccactgtggatcaaacattaccaaacggagcaaaggtaaaataa

DBGET integrated database retrieval system