KEGG   Bacillus sp. X1(2014): HW35_10370Help
Entry
HW35_10370        CDS       T03242                                 

Definition
(GenBank) heat shock protein Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
gst  Bacillus sp. X1(2014)
Brite
KEGG Orthology (KO) [BR:gst00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gst03110]
    HW35_10370
Chaperones and folding catalysts [BR:gst03110]
 Heat shock proteins
  HSP33
   HW35_10370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 Bile_Hydr_Trans
Motif
Other DBs
NCBI-ProteinID: AIM16628
UniProt: A0A077JA10
LinkDB All DBs
Position
2000563..2001441
Genome map
AA seq 292 aa AA seqDB search
MKDYLVKALAYNGTIRAYAVRTTETISEAQSRHQTWRTASAALGRAMTAGVMMGAMLKGD
AKLTIKIDGGGPIGPILVDANAKGEVRGYVTNPHVDFEANEHGKLDVRRAVGTEGMLSVV
KDIGLRDFFSGQVPLVSGELGEDFTYYFATSEQIPSSVGVGVLVNPDDTILAAGGFILQV
LPGAEDAVITQLEERLKTIPPISKLIERGLTPEDILDELFGKGQAKILETMPVRFQCTCS
KERFADAIVGLGAKEINEIIVEEGKAEAHCHFCNEKYLFTKEELEELKKEAK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattatttagtaaaagcacttgcttataacggtacgattagagcttatgcggtg
cgtacaactgaaaccattagtgaggcgcaatctcgtcatcaaacctggcgcacagcttca
gctgcacttggccgcgcgatgaccgcaggggtaatgatgggagcaatgcttaaaggggat
gcgaagctgaccataaaaattgatgggggtggacctattggccccattcttgttgatgcg
aatgccaagggggaagtccgcggttatgttaccaatcctcatgttgattttgaagcgaac
gaacacggaaagcttgatgtccgccgtgcggtcgggacggaaggtatgttatcagttgta
aaagatatcgggctacgtgatttcttttctggccaagttccgctagtctctggggagtta
ggtgaggactttacttattattttgcgacgtcagaacaaattccttctagtgttggagta
ggagtattagtgaacccggatgataccatattagcggctggtggttttattttacaggtt
ctccctggagctgaagatgcagtcattacacaattggaagaacgtttaaaaacgatcccg
ccaatttctaaattaattgaacgtggtctaacccctgaggacattttggatgagttattt
ggtaaaggacaggcaaaaattttagaaaccatgccggttcgtttccaatgtacgtgttct
aaagagcgttttgccgatgcgatcgtcgggttaggtgcgaaggaaattaatgaaataatt
gtggaggaaggaaaggctgaagcgcattgccacttctgtaatgaaaaatacctctttacg
aaagaagaacttgaagaactgaaaaaagaagcaaaatag

DBGET integrated database retrieval system