KEGG   Bacillus sp. X1(2014): HW35_10705Help
Entry
HW35_10705        CDS       T03242                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
gst  Bacillus sp. X1(2014)
Brite
Translation factors [BR:gst03012]
 Eukaryotic Type
  Elongation factors
   HW35_10705 (tuf)
 Prokaryotic Type
   HW35_10705 (tuf)
Mitochondrial biogenesis [BR:gst03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HW35_10705 (tuf)
Exosome [BR:gst04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HW35_10705 (tuf)
  Exosomal proteins of breast cancer cells
   HW35_10705 (tuf)
  Exosomal proteins of colorectal cancer cells
   HW35_10705 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AIM16667
UniProt: A0A077J7Q5
LinkDB All DBs
Position
2059239..2060426
Genome map
AA seq 395 aa AA seqDB search
MAKAKFDRSKPHVNIGTIGHVDHGKTTLTAAITSVLAKQGKAEARAYDQIDGAPEERERG
ITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRQVGVPYLVVFMNKCDMVDDEELLELVEMEVRDLLSEYEFPGDEIPVIKGSALKALE
GDPQWEEKIIELMNAVDEYIPTPTRDTDKPFMMPVEDVFSITGRGTVATGRVERGVVKVG
DAVEIVGFTDEPKSTTVTGVEMFRKLLDFAEAGDNIGALLRGISRDEVERGQVLAKPGSI
TPHTKFKAQVYVLSKEEGGRHTPFFSNYRPQFYFRTSDITGIITLPEGTEMVMPGDHIEM
SVELIAPVAIEEGTKFSIREGGRTVGSGSITAIVE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagctaaatttgaccgctcaaagccacacgttaacattggtacaattggtcac
gttgaccatggtaaaactactttaacagctgcaattacttctgttcttgctaagcaaggt
aaagcagaagctcgtgcatacgatcaaatcgacggtgctccagaagaaagagaacgtggt
atcacaatctctactgcacacgttgagtatgaaacagatgcacgtcactatgctcacgtt
gactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgcacaaatggac
ggcggtatccttgttgtatctgctgctgacggtccaatgccacaaactcgtgagcacatt
cttctttctcgtcaggtaggtgtaccataccttgttgtattcatgaacaaatgcgacatg
gttgatgacgaagaactacttgaactagtagaaatggaagttcgtgaccttctttctgag
tatgagttccctggagatgaaattccagttatcaaaggttctgctcttaaagcactagaa
ggcgaccctcaatgggaagaaaaaatcattgaattaatgaacgctgttgacgagtacatt
ccaactccaactcgtgacactgacaaaccattcatgatgccagttgaggacgtattctca
atcactggtcgtggtacagttgctactggacgcgtagaacgcggtgtagttaaagttggt
gacgcagttgagatcgttggtttcactgatgagccaaaatctactactgtaactggtgta
gaaatgttccgtaaacttcttgactttgctgaagctggtgacaacatcggtgcacttctt
cgtggtatttcacgtgatgaagtagagcgtggacaagtattagcaaaaccaggttctatc
actccacatacaaagttcaaagcacaagtttacgtattatctaaagaagaaggtggacgt
catactccattcttctctaactaccgtccacaattctatttccgtacttctgatatcact
ggtatcattactcttccagaaggtacagaaatggttatgcctggagaccacattgaaatg
tctgtagaacttatcgctcctgttgcgatcgaagaaggaactaagttctctatccgtgaa
ggtggacgtactgtaggttcaggttctatcactgcaatcgttgagtaa

DBGET integrated database retrieval system