KEGG   Bacillus sp. X1(2014): HW35_11420Help
Entry
HW35_11420        CDS       T03242                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gst  Bacillus sp. X1(2014)
Pathway
gst00473  D-Alanine metabolism
gst01100  Metabolic pathways
gst01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gst00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HW35_11420
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HW35_11420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gst01011]
    HW35_11420
Enzymes [BR:gst01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HW35_11420
Peptidoglycan biosynthesis and degradation proteins [BR:gst01011]
 Precursor biosynthesis
  Racemase
   HW35_11420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C SH3_5
Motif
Other DBs
NCBI-ProteinID: AIM16783
UniProt: A0A077JAB4
LinkDB All DBs
Position
2179210..2180367
Genome map
AA seq 385 aa AA seqDB search
MEEVECFYRDTWVEVDLERITENIRSIQSLLPQGVDMIAVVKANAYGHGDIQVAKTALEA
GATYLAVAFLDEAIALRKNGINAPILVLGASRPQDCQIAARNHITLTVFQKEWLEEAKNY
LKAEDRFKFHLKIDTGMGRIGVRTSEEIDEIEEIIANDDRFELEGVFTHFATADELDNTY
FEHQLVKFEKLVASLAKKPKYIHSSNSAASIRFPRAYFNAVRVGIAMYGLTPSLEMEKEI
PFPLKEAFSLKSKLIHVKKLQKGDKVSYGATYTSEGEEWIGTIPIGYADGWIRKLQGQEV
LVNGIRSPIVGRICMDQCMVRLPYHVPVGTEVTLIGRQKEEVISVNEIAAKLDTINYEVT
CIISKRVPRLYKKGGKFVEVKNYLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagtggaatgcttttatagagatacatgggtggaagtggatctggaacgaatt
acagaaaatatacgatctattcagagtcttctccctcaaggcgtggatatgattgcggtg
gtaaaggcaaatgcctatggacatggtgatatccaagtggcaaaaacagcgttagaagca
ggggctacctatttggcagttgcctttttagacgaagcaatagctctaagaaaaaatggg
atcaacgcaccaattcttgtattaggcgctagccgtcctcaagactgtcaaattgcggca
aggaatcatattaccttaactgtttttcaaaaagaatggctcgaggaagcaaaaaattat
ttaaaagctgaggacagatttaaatttcatttgaaaatagacactggcatgggaagaatc
ggtgtacgaacgagcgaggaaatagatgagattgaggaaataatcgccaatgatgatcgg
tttgagctcgaaggcgtttttacccattttgccacagcagatgaattggacaacacttat
tttgaacatcaattggtgaaatttgaaaagctggttgcctctcttgctaaaaagccaaag
tatattcattcgagtaatagcgccgcatcgattcggtttccaagagcttattttaatgcc
gttcgagtcgggattgccatgtacggtttaaccccttcgttagaaatggaaaaagaaatc
ccttttccgttaaaggaagctttctcattaaagtcgaagcttattcatgtaaaaaaactg
caaaagggagataaagtgagctatggcgccacttatacgagtgaaggagaagaatggatt
ggaacaataccaattgggtatgctgacggctggattcgaaaacttcaggggcaggaagtg
cttgttaatggaattcgctcaccgattgtaggaagaatctgtatggatcaatgtatggtt
cgccttccgtatcatgttccagttggtacggaggtaactctaattggtagacaaaaagaa
gaagtgatttctgtaaatgaaattgcagccaagcttgatactattaattatgaagtgact
tgtattatttctaaacgtgtccctcgactttataaaaaaggcggaaaatttgtcgaagta
aaaaactatcttctttaa

DBGET integrated database retrieval system