KEGG   Bacillus sp. X1(2014): HW35_11830Help
Entry
HW35_11830        CDS       T03242                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
gst  Bacillus sp. X1(2014)
Pathway
gst00970  Aminoacyl-tRNA biosynthesis
gst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gst00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HW35_11830
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gst03029]
    HW35_11830
Enzymes [BR:gst01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HW35_11830
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HW35_11830
Mitochondrial biogenesis [BR:gst03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HW35_11830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AIM16843
UniProt: A0A077JAF6
LinkDB All DBs
Position
2263688..2265115
Genome map
AA seq 475 aa AA seqDB search
MEFETVIGLEVHVELKTESKIFSDSPNHFGAEPNTNTSVIDLGYPGVLPVLNKKAVEFGM
KAAMALNCEIATYTKFDRKNYFYPDNPKAYQISQFDQPIGQNGWIEIEVDGYKKRIGITR
IHLEEDAGKLNHEKGYSLVDINRQGTPLIEIVSEPDIRTPNEAYAYLEKLKSIIQYTGVS
DCKMEEGSLRCDANISIRPVGQKEFGTKTELKNLNSFNFVRKGLEYEEKRQREIVSAGGK
IEQETRRFDEATGTTILMRVKEGSDDYRYFPEPDLLELYIDEEWKERVRAEIPELPDERQ
KRYIEELGLPVYDAKVLTVVKETADFFEATVKAGADPKQASNWIMGEVSGYLNAEGKELH
EVALTPEGLAGMIKLIENGTISSKIAKTVFKELIENGGNAEQIVKEKGLVQISDEGTLLK
IINEVLDNNPKSIEDFKGGKAKATGFLVGQVMKATKGQANPQMVNKLLNQELQKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgaaacagtgattggacttgaggtccatgtggagttaaaaactgaatcaaaa
atcttttcagatagcccaaatcactttggtgccgaaccaaatacgaatactagtgtcatt
gatctaggctatccgggagtacttccggttctgaataaaaaggcagtggaattcgggatg
aaggcagcgatggcattgaattgcgagattgccacttataccaagtttgaccggaagaat
tatttttacccggataatccaaaggcatatcaaatttcacaatttgaccaaccgattggc
cagaatggttggattgaaattgaagtggatggttataagaaaagaattggaattacaagg
attcatttagaagaagatgctggtaagctgaatcatgaaaaagggtattcattagtggat
attaaccgtcagggaacgccgctaattgaaattgtttctgagccggacattcgaactcca
aatgaagcttatgcctatttggaaaaattaaagtccattattcagtatactggggtttct
gattgtaaaatggaagagggctcacttcgctgtgatgccaatatttcgattcgccctgtc
ggacaaaaagaatttggtacgaaaaccgaattaaaaaacttgaactctttcaactttgtt
cgcaaagggctggaatatgaagaaaagcggcagcgggaaattgtatctgcaggtggtaaa
attgaacaagagacacgccgttttgatgaagcaacaggaacaacgatactaatgcgtgta
aaggaaggctctgatgattaccgatacttcccagaaccagatctgctcgaattatacatt
gatgaagagtggaaagagagggttcgtgcagaaattccagagcttccagatgaacgccaa
aaacgctatattgaagagctagggttgccagtgtatgatgcaaaggttctgacggttgta
aaagaaacggcagatttctttgaagcaacagtgaaagctggtgccgatccgaagcaggca
tctaactggatcatgggagaagtttccggttacttgaatgcagaaggaaaagagttgcat
gaagtggctttaacacctgaaggacttgctggcatgattaaactgattgaaaatggcacc
atttcttctaaaattgccaagaccgtttttaaagagttaattgaaaacggcggtaatgct
gagcaaatagtgaaagaaaagggacttgtgcaaatatctgatgaaggtaccttattaaag
attatcaatgaagtccttgataacaacccgaaatctattgaagatttcaaaggtggcaag
gcgaaagcaacaggcttccttgttggacaagttatgaaggcgacaaagggtcaagccaat
ccacaaatggttaacaaacttttaaatcaagagttgcagaaacgttaa

DBGET integrated database retrieval system