KEGG   Bacillus sp. X1(2014): HW35_13440Help
Entry
HW35_13440        CDS       T03242                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
gst  Bacillus sp. X1(2014)
Brite
KEGG Orthology (KO) [BR:gst00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HW35_13440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease Chordopox_A13L
Motif
Other DBs
NCBI-ProteinID: AIM17121
UniProt: A0A077J8C1
LinkDB All DBs
Position
2594809..2596224
Genome map
AA seq 471 aa AA seqDB search
MNLFRKKSIQALIQEAGNKEVTLKKDLGAFDLTMLGIGAIVGTGIFVLTGVAAAIHAGPA
LIISFILSGLACIFAALCYAEFASIVPVSGSAYTYSYAIFGEIVAWLLGWVLILEYGLAA
SAVASGWSGYFQGLLSGFGIHLPKAITSAYNPTEGTFIDVPAIFILVIITYLLTQGAKKS
ARFNTVMVIIKVTVVLLFLGVGVWYVKPENWTPFMPFGFSGVAAGAATVFFAYIGFDAVA
TAAEEVKRPQRDLPIGIIASLLICTLLYIVVSAVLTGIVPYTDLNVKNPVAFALSYIHQD
WVAGFISIGAIAGITTVLLVMLYGQTRLFYAISRDGLLPKFFTKVSKKKQTPVVNSWITC
LIVSFFAGVVPLNKLAELVNIGTLSAFMTVSIGILYLRKNNQTLNTGFRVPLVPLIPILA
FLFCGYLALQLPALTWISFAVWIVIGLLVYFVYGRKHSSLNHTEEKVKKVS
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaacttatttagaaagaagtcgattcaggctctgatccaagaggctggaaataaagag
gttactctaaagaaggatttgggtgcctttgatttaacaatgcttggaattggagctatc
gtgggcacaggaatttttgttcttacaggagtggcggctgctatacatgctgggccagcg
ttgattatatcttttatattatcaggtttagcttgtatctttgctgcactttgctacgca
gaattcgcttctatcgttccggtttccggaagtgcttatacgtatagctatgcaatcttt
ggcgaaatcgttgcctggttactaggctgggttttaatactcgaatatggtctcgccgca
tctgcggtagctagcggttggtcaggttattttcaaggtttactatcaggatttggaatc
catttacctaaagcgataactagtgcatacaatccaacagagggaacgtttatcgatgtt
ccagctatttttatactggtcatcatcacatacttattaacacaaggtgcgaaaaaatca
gcccgcttcaatacagtgatggtcattattaaagtgaccgttgtcctgctcttccttggt
gtcggtgtttggtatgtgaaacctgaaaactggactccatttatgccatttggtttctct
ggcgtagcggccggagcagcaactgtattttttgcttacattggttttgatgcagttgcc
actgcagcagaagaggtgaaaagaccacagcgtgatttaccgattggaattattgcttct
ctgctaatttgtacacttttatatattgtcgtatctgctgttctaacagggatcgttcct
tatacagatctaaatgtgaaaaacccagttgcctttgcattaagttatattcatcaggat
tgggttgctggtttcatttctataggggctattgcaggtattacaacggtattgctcgtt
atgctatatggtcaaactcgtttattctatgcgattagccgtgatggtttattgccaaag
ttttttacgaaagtgagcaagaaaaaacagacaccggttgtgaactcctggattacttgt
ctaatcgtatcgtttttcgctggagttgtgcctttaaataaattggcggaacttgtcaat
atcggaacgttatctgcctttatgacggtttcaattggtattttatatttgagaaaaaat
aatcaaacattaaatactggatttagagtgccgcttgttccactaatcccaattttggca
tttttattctgtggctacttggcactgcaactcccagcactgacttggattagctttgct
gtttggatagtgataggactattggtctacttcgtgtatggacgaaaacattcatcatta
aatcatactgaagaaaaagtgaaaaaagtaagttag

DBGET integrated database retrieval system