KEGG   Bacillus sp. X1(2014): HW35_14870Help
Entry
HW35_14870        CDS       T03242                                 

Definition
(GenBank) sodium ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
gst  Bacillus sp. X1(2014)
Brite
KEGG Orthology (KO) [BR:gst00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gst02000]
    HW35_14870
Transporters [BR:gst02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    HW35_14870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_27 Polysacc_deac_2 AAA_23 SbcCD_C AAA_22 AAA_29
Motif
Other DBs
NCBI-ProteinID: AIM17354
UniProt: A0A077J7F0
LinkDB All DBs
Position
2862640..2863539
Genome map
AA seq 299 aa AA seqDB search
MVLQIDHVTKRFGTFTAVNNLSLTIPEKEMFGFLGANGAGKTTTFRMILGLLDPSEGRIT
WDGKELNYSTSHLVGYLPEERGLYPKLKVRDQIIYLARLRGMSKREALKELRWWLERFKV
PEYENKRVEELSKGNQQKIQFIAAVLHKPKLLILDEPFSGLDPVNVELLKEAVLSLKESG
TTIVFSSHQMHHVEEMCEHLCILHKGKPVVHGSLKEIKRAIGKKNLIIHADFSLDALNQF
PGVVKVKNTTEGMDLQIEGEHVAQRILTEIAGKGFIRKFALEEPSLNDIFIEKVGDSYE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggttcttcaaatagatcatgtaacaaaacgatttggtacatttactgccgttaataat
ttgtcactaaccattcccgaaaaggagatgtttggctttttgggagcaaatggtgccggt
aagacgaccacgtttcggatgatattgggacttttggatccgagtgagggtaggattact
tgggatggaaaggaactaaactactctacgagtcatcttgtcggttatcttccagaggaa
agaggcctttatccaaaattaaaggtccgtgatcaaatcatatatttagctagattaaga
gggatgtctaaaagggaagctttgaaagagttaagatggtggttagagagatttaaagtt
ccagagtatgaaaataaaagagtggaagagctatcgaaagggaatcagcagaaaattcaa
ttcattgctgccgttttacataaaccaaagctgttgattttagatgaaccattcagtggt
cttgacccagttaatgtggaacttttaaaagaggccgtattgtcattgaaagaaagtggg
actacgattgtgttttccagccaccaaatgcatcatgttgaggaaatgtgtgagcatttg
tgcatcttacacaaaggcaagccagttgtccatgggtctttaaaagaaattaaacgggcc
atcggtaaaaagaatctaatcattcatgctgacttttcattggatgcactaaatcaattt
ccaggtgttgtcaaggtgaaaaacacaacagaaggtatggatttacagattgagggggaa
catgtcgcccaaaggattcttactgagatcgcagggaaagggtttattcggaaatttgcc
ttagaagaaccttcattaaatgatatttttattgagaaagtaggtgattcttatgaataa

DBGET integrated database retrieval system