KEGG   Bacillus sp. X1(2014): HW35_15410Help
Entry
HW35_15410        CDS       T03242                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
gst  Bacillus sp. X1(2014)
Pathway
gst00061  Fatty acid biosynthesis
gst00780  Biotin metabolism
gst01100  Metabolic pathways
gst01130  Biosynthesis of antibiotics
gst01212  Fatty acid metabolism
Module
gst_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gst00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HW35_15410
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HW35_15410
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HW35_15410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gst01004]
    HW35_15410
Enzymes [BR:gst01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     HW35_15410
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     HW35_15410
Lipid biosynthesis proteins [BR:gst01004]
 Fatty acid synthase
  Component type
   HW35_15410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AIM17449
UniProt: A0A077J7P6
LinkDB All DBs
Position
2968129..2968899
Genome map
AA seq 256 aa AA seqDB search
MNLSLAGKTFVVMGVANKRSIAWGIARSLHKAGARLIFTYAGERLESSVRELAESLEAEG
TIVLPCDVTSDEAITKCFAEIKEAVGTIHGVAHCIAFANKEELQGEYLNTTREGFLLAHN
ISSYSLTAVAKEARSLMTEGGSIVTLTYLGGERAIKNYNVMGVAKASLDSSVRYLAADLG
KDNIRVNSISAGPIRTLSAKGVSDFNSILKEIEEKAPLRRTTTPEEVGDTALFLFSDLSR
GITGENIHVDSGYHIL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatctttcattagccggaaaaacatttgttgtaatgggtgtagcaaataaacgcagt
attgcttggggaattgcacgctccttacataaagcaggagcacgtttaatatttacttat
gcaggagaaaggctagaaagcagtgtccgtgaattggcagagtcgttagaagcggaggga
actattgtacttccatgtgatgtaacgagtgatgaagcaattactaaatgttttgctgag
attaaagaggcagtagggaccattcacggagttgctcactgtattgcttttgctaataaa
gaagagcttcagggagaatatttgaacacgacaagagagggtttcttgcttgctcataat
attagttcttattctttaactgcggtagcgaaggaagctcgcagtttaatgactgaaggt
ggcagcattgttactttaacgtatcttggcggtgagcgtgccattaagaattacaatgta
atgggcgtagcaaaagcttccttggattcaagtgtccgttacttagcagcagatcttgga
aaagacaatattcgtgtgaactcaatctctgccggtcctatcagaactttatcagctaaa
ggtgtaagtgattttaactccattttgaaggaaattgaagaaaaagcgccattgcgtaga
acaactacacctgaagaagttggagatacagcattattcctatttagcgacctttcgcgt
ggaattaccggtgaaaatatccatgtagactcaggttatcatattttataa

DBGET integrated database retrieval system