KEGG   Bacillus sp. X1(2014): HW35_16575Help
Entry
HW35_16575        CDS       T03242                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gst  Bacillus sp. X1(2014)
Brite
KEGG Orthology (KO) [BR:gst00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gst01001]
    HW35_16575
Enzymes [BR:gst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     HW35_16575
Protein kinases [BR:gst01001]
 Serine/threonine kinases: Other
  Bacterial family
   HW35_16575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo Kinase-like Seadorna_VP7 Haspin_kinase PIP49_C RIO1 Elong_Iki1 DUF3671 Pkinase_fungal YukC YrbL-PhoP_reg FTA2 Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AIM17659
UniProt: A0A077J890
LinkDB All DBs
Position
3186755..3188728
Genome map
AA seq 657 aa AA seqDB search
MMIGKRLSGRYKIIDMIGGGGMANVYLAHDMILDRDVAVKMLRMDFANDEEFIRRFRREA
QSATSLAHPNIVNIYDVGEENDLYYIVMEYVDGQTLKQYIQQNSPLRVEKALEIMKELAS
AISHAHQNQIIHRDIKPQNILIDHNGNVKITDFGIAMALSATTITQTNSVLGSVHYLSPE
QARGGMATRKSDIYSLGIVMFELLTGRLPFSGESAVSIALKHLQSETPSVRRWNPNIPQS
VENIVLKATAKDPFHRYNSVEEMEEDLSTALDPERINEPKFVIPVDDEATKAIPVITDDK
PLKNLDQTIVHSSEKISDSPENNEKKEKSVKKKRKKWPIVLASIFLIVLIGLSALLLPEF
FSAKEIKIPDVSGMNEGDAVSKLKLEGLDVGKKIEINDENIDKGLVIKTDPKAGTTVKEN
AKITLYISLGKEEFELSDYTGQQYEDVLRILEKENFKNIEVTEIHDESAPGTIISQSPSP
GEKVIPEETDLEFEVSKGPEKIILRDLTQYNLKGAQDYAFSEGLELSVSQEVYHDTIPQG
MIISQSPEPGTELNKGDKVTVVISKGKEEKPPKEITKEITIDYEPPVPGEPGQQQEVIIY
IDDLNHSMTEPAETFFITETTRKQIKLIIPYGKKAGYKVIRDSKVIAEEVINYDDTE
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgatgattggaaaaagattaagtggccgctataaaataatagatatgatcggcggcggt
gggatggccaatgtctacttagcccatgatatgatccttgatcgtgatgttgctgtcaaa
atgctgcgcatggactttgctaatgatgaagaatttattagaaggtttcgaagagaggct
cagtcggcaacaagtcttgcccaccctaatatcgttaatatttatgatgttggtgaagaa
aacgatctttactatattgtcatggaatatgttgatggacaaacattgaaacaatacata
caacaaaattcacctctcagggtggaaaaggcacttgagatcatgaaggagcttgcctcc
gccatttcacatgctcaccaaaatcaaattatccaccgtgatattaaaccgcagaacatt
ctcattgatcataatgggaatgtgaaaattactgattttggtatcgccatggctctaagt
gcaacaaccattactcaaacgaattcagttttaggttccgttcattacctttctccggag
caggccagaggaggtatggctactcgaaaatcggatatttattcccttgggattgtgatg
tttgagttactaaccggcaggcttccattttcaggtgaatctgcggtttctattgcgcta
aaacatcttcaatcggaaacaccttctgttagaagatggaatcccaatataccacaaagt
gtagagaacatcgttttaaaagcaaccgcaaaagatccattccatcgctacaatagcgtg
gaagaaatggaagaagatttatcaacagctcttgacccggagagaatcaatgaaccaaag
tttgtgatccctgtagatgatgaagcaacaaaggctataccggttattacagatgacaaa
ccattaaaaaatcttgatcaaaccattgtacacagtagtgaaaaaataagtgattcacct
gaaaataatgagaaaaaagaaaaaagtgtcaagaaaaaaagaaaaaaatggcccattgtt
ttggcatctatatttttaattgtgctaataggcctctctgcactgttattacctgaattc
ttctcagcaaaagaaattaaaattcctgatgtttcagggatgaatgaaggagacgcggtc
tcaaagttaaaacttgaaggtctagacgttggtaaaaaaatagaaataaacgatgagaat
attgataaaggcctggttattaaaaccgatcctaaagccggtacaaccgtgaaggaaaat
gcgaagattaccctttatattagtttaggaaaagaagaattcgaactatccgattataca
gggcaacaatatgaggatgtacttcgtatattagaaaaggaaaacttcaagaatatagaa
gttacggagatccatgatgagagtgcgcctggaacgataataagtcaaagtccttcccca
ggggaaaaggtaattccggaagaaacggatttagaatttgaggttagtaaagggccggaa
aaaattattcttagggacttgactcaatacaatttaaagggtgctcaagactatgctttt
tcggagggattagaattatctgtatcgcaagaggtatatcatgataccatcccacaaggc
atgattatttctcaatcgcctgaaccggggacagaactaaataagggtgacaaggtaaca
gtcgtgatatcaaagggaaaagaagaaaaaccacctaaagaaattacgaaagaaataacg
attgattacgagccacctgtacctggtgaaccgggacaacagcaagaggttattatttat
atcgacgatttgaatcacagtatgacggaaccggcagaaacattttttataacagaaaca
acaagaaaacaaattaagctgataattccttatggaaagaaagccggatacaaggtgatt
agagattccaaagtaattgcggaagaagtcattaattatgatgatacggagtaa

DBGET integrated database retrieval system