KEGG   Geobacter sulfurreducens PCA: GSU0371Help
Entry
GSU0371           CDS       T00155                                 

Definition
(RefSeq) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00500  Starch and sucrose metabolism
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GSU0371
Enzymes [BR:gsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     GSU0371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-GeneID: 2686696
NCBI-ProteinID: NP_951430
UniProt: Q74G76
LinkDB All DBs
Position
complement(403250..405814)
Genome map
AA seq 854 aa AA seqDB search
MDFTKRIHRFTVVPSLSGELAILQTLAYNLWWTWEPDAVELFKRLDIDLWQQTRHNPVEM
LGILQQTTLERLVADEGFMAQLKRVEEKYHGYMTGKTWFDRTWNGERPLRVAYFSMEFGL
HESVPTYSGGLGVLAGDHLKSASDLGIPLVGIGLLYRQGYFRQYLNIEGWQQELYPENDF
YNLPLKLQRDEEGQPVTIELDLAGRKVHVQIWKVQVGRIPLYLLDTNMEENDPLDREITA
QLYGGDQDMRIRQEILLGIGGIRALNRLGIDPNVCHMNEGHAAFLALERTKLLMEKHGLR
FPEAMEAVRAGTIFTTHTPVDAGIDHFPADLLERYLGRYYRFLGLSRDEFLSLGRQLPKN
PHESFCMAVLALRLANHANGVSQLHGEVSRKMWKNLWPELPDEHIPITSVTNGVHTKTWL
SVEMAGLLTRYLGNRWREDPTDSLLWKRVANIPDSELWRTHERCRERLVVFARRRLKDHL
HQVGATAKEIAQADEVLDPEALTIGFARRFATYKRGTLLFRDLDRLARILNDADRPVQII
FSGKAHPHDVEGKELIRRIFQHSLEARFHNRIVFIEDYDMAVARHLVQGVDVWLNTPLRP
LEASGTSGMKVAFNGGLNMSVLDGWWPEGYRGNNGWAIGKGEVYDDIDFQNEVESRAIYD
LLEKEVIPLFYDRGPDGIPRGWLACMKASLQTLCPVFSTERMVKEYAERMYLPSFEEWRT
LAGDGLARAVDLARWKGEMHRSWHQVKVISVEAPAPEEVPLGAPIPVTARIALGDIVPDR
VIVETYCGVLDSRGNIVGGELIPLDHAEEEGGGSHRFTGDIETRFCGRHGFMIRVMPRHP
ELGPVYEQGLLVWG
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggacttcaccaagagaatccaccgtttcaccgttgtcccttccctgtcgggggaactc
gccatcctccagaccctggcctacaatctctggtggacgtgggagcctgatgcggtggaa
ctcttcaagcggctcgacatcgacctgtggcagcagactcgccacaacccggtggagatg
ctcggcatcctccagcaaaccacccttgagcgccttgtggcggacgagggcttcatggcc
cagctcaagcgggtcgaggaaaaataccacggctacatgaccggcaagacgtggttcgat
cggacctggaacggcgagcgtcccctgcgggttgcctatttctccatggagttcggtctc
cacgaatcggttcccacctactccggcggcctgggggtgctggcgggggatcatctcaag
tcggccagcgacctgggaatccccctggtggggatcggcctcctctaccgccagggctac
ttccgccagtatctcaatatcgaagggtggcagcaggagctctaccccgagaacgacttc
tacaacctccccctcaaactccagcgggacgaggaagggcaaccggtcaccatcgagctc
gatctggccggccgcaaggtccacgtccagatctggaaggtgcaggtgggccggattccc
ctctatctcctggacaccaacatggaggagaacgacccgctggaccgggagatcacggcc
cagctctacggcggggaccaggacatgcgcatccgccaggagattctgctgggcatcggc
ggcatccgggcgttgaaccgcctcggcatcgatcccaatgtctgccacatgaacgagggg
cacgccgccttcctggccctggagcggaccaagctcctcatggaaaagcacggcctgcgc
ttcccggaggccatggaagcggtccgcgccggcaccatctttacgacccatactcccgtg
gacgcgggtatcgaccatttccccgcagacctgctggaacgctatctgggacgctattac
cggttcctggggctctcccgggatgaattcctctccctgggacgccagctgccgaaaaat
ccccacgaatcgttctgcatggcggtgctggccctgcggctggccaatcacgccaacggc
gtcagccagcttcacggcgaggtctcgcgcaagatgtggaaaaacctctggcccgagctg
cctgacgagcacatccccatcacctccgtcaccaacggcgtccacaccaagacctggctc
tcggtggagatggccgggctcctcacccgctacctgggcaaccgctggcgggaagacccc
accgactcgctcctctggaagcgggtcgccaacattcccgactccgaactctggcggact
cacgaacggtgccgcgaacggctggtggtctttgcccggcgccggctcaaggatcacctg
caccaggtgggcgccacggccaaggagatcgcccaggccgacgaggtgctggacccggaa
gccctgaccatcgggttcgcgcggcgcttcgccacctacaagcgggggaccctgctcttc
cgggacctggaccggctcgcccgcatcctcaacgacgccgaccgccccgtgcagatcatc
ttctcgggcaaggcccatccccacgacgtggagggcaaggaactgatccgccgcatcttc
cagcactccctggaagcgcgattccacaaccggatcgtgttcatcgaggactatgacatg
gccgtggcccggcacttggtccagggggtcgacgtctggctcaacacccccctgcgcccc
ctggaggccagcggcaccagcggcatgaaggtggcgttcaacggcggcctcaacatgagc
gttctggacggctggtggcccgagggataccgggggaacaacggctgggctatcggcaag
ggtgaggtctacgacgacatcgacttccagaacgaggtggagagccgcgccatctacgac
ctgctggaaaaggaggtcatccccctcttctatgaccggggtcccgacggcatcccccgc
ggctggctcgcctgcatgaaagcgagcctccagaccctgtgcccggtcttcagcaccgag
cggatggtcaaggagtatgccgagcggatgtacctcccctccttcgaggagtggcgcacc
ctggccggcgacggtctggcccgggccgtggatctggcccgctggaagggtgagatgcac
cggtcctggcaccaagtgaaagtgatttcggtggaggcccccgcccccgaggaggtgccc
ctgggcgcgcccattccggtgactgcccgtattgccctgggcgacatcgtcccggaccgg
gtgattgtggagacctactgcggcgtcctcgactcccggggcaacatcgtgggaggcgag
ttgattccgctggaccacgcggaagaggaagggggaggctcccaccgcttcacgggtgac
atcgaaacccggttctgcggcaggcacggtttcatgatccgggtcatgccccgccatccc
gaactgggaccggtttacgaacagggtctgctcgtctggggctga

DBGET integrated database retrieval system